Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr38960katAXFF4834R_chr38960catalase

katA XFF4834R_chr38960
XFF4834R_chr38950
XFF4834R_chr38950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4146
XFF4834R_chr_4146
ID katA
AC XFF4834R_chr38960
LT XFF4834R_chr38960
OR XFF4834R_chr from 4485511 to 4487034 on strand -
DE catalase
IP Catalase; Catalase-related immune responsive
CL 5.5.6 Other stresses (mechanical, nutritional, oxidative) GO:0009612 GO:0007584 GO:0006979
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: response to oxidative stress (GO:0006979)
Molecular Function: catalase activity (GO:0004096)
Molecular Function: heme binding (GO:0020037)
Molecular Function: iron ion binding (GO:0005506)

Curated
PM
AN gene decrit chez Xanthomonas campestris pv. phaseoli, kat A - AUTHORS Chauvatcharin,N., Vattanaviboon,P., et al. TITLE Cloning and characterization of katA, encoding the major monofunctional catalase from Xanthomonas campestris pv. phaseoli and characterization of the encoded catalase KatA JOURNAL Curr. Microbiol. 46 (2), 83-87 (2003) PUBMED 12520360
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100421)
MW 56319.1 Da
SQ 507 aa
 
........10........20........30........40........50
| | | | |
MRPGPLMVLALLAPTLIAPPVFAQSVLTRDNGAKVGDNQNSQTAGATGPT
LLQDVQLIQKLQRFDRERIPERVVHARGTGVKGEFTATADLSNLTKAKVF
SAGEKTPVFVRFSSVVHGNHSPETLRDPHGFATKFYTSEGNWDLVGNNFP
TFFIRDAIKFPDMVHAFKPDPRTNLDDDSRRFDFFSHVPEATRTLTLLYS
NEGTPAGYRFMDGNGVHAYKLVNAQGEVHYVKFHWKTLQGIKNLDPKQVA
AVQAKDYSHLTNDLVGAIKKGDYPKWDLYVQVLKLQDLAKFDFDPLDATK
IWPDVPEQKVGQMVLNKNVDNFFQETEQVAMAPANLVPGIEPSEDRLLQG
RIFSYADTQLYRIGANGLSLPVNRPRVAVNNGNQDGQGNIGQTTSGVNYE
PSRLEPRPQDTAARYSELPLSGTTQQAKITREQNFKQAGELYRSYSKKDR
ADLVQSFGESLAATDTESKHLMLSFLYKADPEYGTGVTRVAKGDLARVKQ
LASSLQD
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr33290 lcl|katE-XFF4834R_chr33290

27

493

S=852 I=41 E=1.67369e-96

hydroperoxidase HPII(III) (catalase)

XFF4834R

XFF4834R_chr33290 lcl|katE-XFF4834R_chr33290

27

493

S=852 I=41 E=1.67369e-96

hydroperoxidase HPII(III) (catalase)

X.species

YP_365853.1 lcl|catB-XCV4122

1

507

S=2426 I=92 E=0

catalase precursor

X.species

NP_639288.1 lcl|catB-XCC3949

1

507

S=2418 I=91 E=0

catalase precursor

X.species

lcl|catB-XALc_2991

1

507

S=2169 I=80 E=0

probable catalase precursor protein

X.species

NP_644328.1 lcl|catB-XAC4029

116

507

S=1931 I=93 E=0

catalase precursor

X.species

YP_362971.1 lcl|katE-XCV1240

27

493

S=867 I=41 E=1.08699e-97

catalase

X.species

NP_641547.1 lcl|katE-XAC1211

27

493

S=853 I=40 E=5.3554e-96

catalase

X.species

NP_636484.1 lcl|katE-XCC1109

27

466

S=848 I=41 E=2.16089e-95

catalase

X.species

NP_644329.1 lcl|catB-XAC4030

1

110

S=479 I=87 E=1.0543e-50

catalase

X.species

NP_639245.1 lcl|srpA-XCC3905

43

358

S=168 I=25 E=4.61967e-13

catalase

X.species

lcl|XALc_0265

72

358

S=160 I=25 E=4.57574e-12

hypothetical catalase precursor protein

X.species

NP_644290.1 lcl|srpA-XAC3990

43

358

S=157 I=23 E=9.11162e-12

catalase

X.species

YP_365814.1 lcl|srpA-XCV4083

43

367

S=150 I=23 E=7.07008e-11

catalase

pubmed

1

507

S=2440 I=92 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 12520360

 

prodomImg

pubmed

21

507

S=2169 I=83 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

Pubmed 7546603

 

prodomImg

pubmed

1

507

S=2027 I=74 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

Pubmed 7592431

 

prodomImg

pubmed

26

507

S=1876 I=72 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 12595451,12949187

 

prodomImg

pubmed

27

495

S=1173 I=49 E=2.79731e-133

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 17198371

 

prodomImg

pubmed

27

506

S=1161 I=48 E=8.16803e-132

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 16597942

 

prodomImg

pubmed

27

506

S=1161 I=48 E=9.22844e-132

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 16597942

 

prodomImg

pubmed

27

493

S=1160 I=49 E=1.27417e-131

Catalase EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 1860824

 

prodomImg

pubmed

27

493

S=1152 I=49 E=1.01489e-130

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 16597942

 

prodomImg

pubmed

27

484

S=1133 I=48 E=1.93149e-128

Catalase-1 EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 8819328,9584109

 

prodomImg

sp

21

507

S=2169 I=83 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

 

prodomImg

sp

1

507

S=2027 I=74 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

 

prodomImg

sp

27

503

S=1468 I=59 E=3.98677e-169

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

 

prodomImg

sp

21

503

S=1453 I=58 E=2.78387e-167

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

 

prodomImg

sp

21

503

S=1448 I=58 E=1.09428e-166

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Periplasm Peroxidase Signal

 

prodomImg

PD000510

26

499

S=1130 I=49 E=2.52592e-129

PDA7Q7T1

24

83

S=138 I=47 E=4.3183e-09

PDA0C3F7

148

364

S=124 I=25 E=2.01912e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JyF0qF9b)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

256 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBW9rGJb/XFF4834R_chr38960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBW9rGJb/XFF4834R_chr38960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBW9rGJb/XFF4834R_chr38960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBW9rGJb/XFF4834R_chr38960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.