Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr38950XFF4834R_chr_4484884_4485453_r1_XFF4834R-XFF4834R_chr38950XFF4834R_chr38950Putative secreted protein

XFF4834R_chr_4484884_4485453_r1_XFF4834R-XFF4834R_chr38950 XFF4834R_chr38950
XFF4834R_chr38940
XFF4834R_chr38940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38960
XFF4834R_chr38960
ID XFF4834R_chr_4484884_4485453_r1_XFF4834R-XFF4834R_chr38950
AC XFF4834R_chr38950
LT XFF4834R_chr38950
OR XFF4834R_chr from 4484884 to 4485453 on strand -
DE Putative secreted protein
IP
CL 7.5 Extracellular GO:0005576
EC
GO InterPro


Curated
PM
AN IPR020683 Ankyrin repeat-containing domain. This entry represents the ankyrin repeat-containing domain. These domains contain multiple repeats of a beta(2)-alpha(2) motif. The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers [1]. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 20295.8 Da
SQ 189 aa
 
........10........20........30........40........50
| | | | |
MRTLLFLMLGSVSVIANAASPASAASATATATPEQIKLQLREYFFDAARE
GRQDMLAEFIRSHYDLNTRDEKGYTALILAAYHGQRPAVEQLLSAGADPC
AQDKRGNTALMGAIFKGELGIAKRLMQADCAPDQRNNAGQTAAMYAALFQ
RTDVLKDLAAKGADLSLKDGQGNDVTKLQRGEFATAPAR
XFF4834R

XFF4834R_chr39520 lcl|XFF4834R_chr_4552610_4555930_r3_XFF4834R-XFF4834R_chr39520

55

163

S=122 I=35 E=1.4469e-08

XFF4834R

XFF4834R_chr39520 lcl|XFF4834R_chr_4552610_4555930_r3_XFF4834R-XFF4834R_chr39520

47

172

S=110 I=31 E=3.39745e-07

XFF4834R

XFF4834R_chr06580 lcl|XFF4834R_chr06850104_0751900_f2_XFF4834R-XFF4834R_chr06580

70

128

S=99 I=42 E=7.63721e-06

predicted transcriptional regulator with ankyrin domain

X.species

NP_644327.1 lcl|ankB-XAC4028

1

189

S=831 I=88 E=6.85844e-94

ankyrin-like protein

X.species

YP_365852.1 lcl|XCV4121

1

189

S=826 I=87 E=2.30436e-93

putative secreted protein

X.species

NP_639287.1 lcl|ankB-XCC3948

1

189

S=774 I=81 E=4.9384e-87

ankyrin-like protein

X.species

lcl|XALc_2990

35

189

S=691 I=85 E=5.16034e-77

hypothetical secreted protein

X.species

NP_644383.1 lcl|ank2-XAC4084

55

163

S=122 I=35 E=4.46466e-08

ankyrin-like protein

X.species

NP_644383.1 lcl|ank2-XAC4084

47

172

S=110 I=31 E=1.44745e-06

ankyrin-like protein

X.species

YP_365901.1 lcl|XCV4170

55

163

S=121 I=35 E=5.74906e-08

putative ankyrin-like membrane protein

X.species

YP_365901.1 lcl|XCV4170

47

172

S=114 I=32 E=4.27064e-07

putative ankyrin-like membrane protein

X.species

NP_639335.1 lcl|ank2-XCC3996

47

172

S=121 I=33 E=6.55231e-08

ankyrin-like protein

X.species

NP_639335.1 lcl|ank2-XCC3996

55

163

S=110 I=33 E=1.22648e-06

ankyrin-like protein

pubmed

1

189

S=860 I=85 E=5.99472e-96

Ankyrin-like protein

Pubmed 12520360

 

prodomImg

pubmed

34

180

S=530 I=68 E=6.16265e-56

Ankyrin AnkF

Pubmed 7590314

 

prodomImg

pubmed

35

189

S=525 I=65 E=2.73691e-55

Ankyrin

Pubmed 7592431

 

prodomImg

pubmed

34

185

S=451 I=53 E=2.64628e-46

Ankyrin B

Pubmed 12595451,12949187

 

prodomImg

pubmed

41

169

S=174 I=36 E=9.11405e-13

Ankyrin homolog ; repeat Signal

Pubmed 8390993

 

prodomImg

pubmed

47

182

S=162 I=35 E=2.52563e-11

Ankyrin homolog ; repeat Signal

Pubmed 8390993

 

prodomImg

pubmed

66

161

S=146 I=41 E=2.23169e-09

Ankyrin homolog ; repeat Signal

Pubmed 8390993

 

prodomImg

pubmed

47

173

S=125 I=32 E=7.48569e-07

Ankyrin homolog ; repeat Signal

Pubmed 8390993

 

prodomImg

pubmed

47

173

S=170 I=34 E=2.29658e-12

Death-associated protein kinase 1 EC=2.7.11.1 ; Alternative splicing ANK repeat Apoptosis ATP-binding Calmodulin-binding Nucleotide-binding

Pubmed 11485996

 

prodomImg

pubmed

47

182

S=133 I=31 E=7.96343e-08

Death-associated protein kinase 1 EC=2.7.11.1 ; Alternative splicing ANK repeat Apoptosis ATP-binding Calmodulin-binding Nucleotide-binding

Pubmed 11485996

 

prodomImg

Iprscan IPR020683 [G3DSA:1.25.40.20]

44

173

Ankyrin repeat-containing domain

Iprscan IPR002110 [PF00023]

47

71

Ankyrin repeat

Iprscan IPR002110 [PF00023]

72

104

Ankyrin repeat

Iprscan IPR002110 [PF00023]

105

137

Ankyrin repeat

Iprscan IPR002110 [PF00023]

138

170

Ankyrin repeat

Iprscan IPR002110 [SM00248]

39

68

Ankyrin repeat

Iprscan IPR002110 [SM00248]

72

101

Ankyrin repeat

Iprscan IPR002110 [SM00248]

105

134

Ankyrin repeat

Iprscan IPR002110 [SM00248]

138

167

Ankyrin repeat

Iprscan IPR002110 [PS50088]

72

104

Ankyrin repeat

Iprscan IPR002110 [PS50088]

138

170

Ankyrin repeat

Iprscan IPR020683 [PS50297]

47

170

Ankyrin repeat-containing domain

Iprscan [seg]

18

33

-

PD028224

108

161

S=216 I=76 E=1.1456e-18

PDA1Q8A9

34

64

S=152 I=94 E=6.57027e-11

PD884354

162

189

S=142 I=100 E=9.71881e-10

PDA408F3

47

134

S=103 I=34 E=5.68621e-05

PDA0H118

70

132

S=101 I=43 E=8.79322e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kt49TIQK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

304 hits
swiss-prot

Swiss-Prot ncbi-blastp

370 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFJUq1j/XFF4834R_chr38950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFJUq1j/XFF4834R_chr38950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFJUq1j/XFF4834R_chr38950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFJUq1j/XFF4834R_chr38950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.