Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr37280XFF4834R_chr40410318_4311265_r3_XFF4834R-XFF4834R_chr37280XFF4834R_chr37280putative LysR family transcriptional regulator

XFF4834R_chr40410318_4311265_r3_XFF4834R-XFF4834R_chr37280 XFF4834R_chr37280
XFF4834R_chr_4590
XFF4834R_chr_4590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37290
XFF4834R_chr37290
ID XFF4834R_chr40410318_4311265_r3_XFF4834R-XFF4834R_chr37280
AC XFF4834R_chr37280
LT XFF4834R_chr37280
OR XFF4834R_chr from 4310318 to 4311265 on strand -
DE putative LysR family transcriptional regulator
IP HTH-type transcriptional regulator HdfR
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 34500.2 Da
SQ 315 aa
 
........10........20........30........40........50
| | | | |
MSRPPLHALQGFVSAVRLGNLSRAAGAMHLTVSALSHQMRALEQRLGYPL
LQRHARGVTATPQGQQLLDRIAPHLDAIAEAFEPFGARREDTLTLSLTPS
MASAWLVPRLGEFLAIHPTIEINLLSSERLVDFERQQQVDAAMRIGAGQW
PGVIAEPLFDEWLVPMASPALIARMGGVEAPPLHQWPLLGDPDDAWSRWF
AAFGGDVPRRYVAVLDESEAHHRAALDGVGVALGRVTRARLLLASGQLVA
LSTQRLKTSWSHYLVYPPRSSTHGGFLAFRTWLQGQAREHAAHAQQATAT
PLAARRRKRSGTLPP
XFF4834R

XFF4834R_chr18380 lcl|XFF4834R_chr_2102017_2103009_r1_XFF4834R-XFF4834R_chr18380

6

283

S=301 I=36 E=5.17829e-30

XFF4834R

XFF4834R_chr14650 lcl|gcvA-XFF4834R_chr14650

1

210

S=288 I=38 E=1.78446e-28

DNA-binding transcriptional dual regulator

XFF4834R

XFF4834R_chr17920 lcl|XFF4834R_chr19100081_2050001_r2_XFF4834R-XFF4834R_chr17920

12

181

S=192 I=32 E=9.59621e-17

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr36050 lcl|XFF4834R_chr39200179_4175075_f3_XFF4834R-XFF4834R_chr36050

6

283

S=172 I=28 E=2.43518e-14

XFF4834R

XFF4834R_chr03070 lcl|metR-XFF4834R_chr03070

19

232

S=161 I=28 E=4.88751e-13

DNA-binding transcriptional activator, homocysteine-binding

XFF4834R

XFF4834R_chr06800 lcl|XFF4834R_chr07150040_0780948_f1_XFF4834R-XFF4834R_chr06800

9

164

S=159 I=31 E=7.82635e-13

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr41800 lcl|XFF4834R_chr_4862828_4863730_r3_XFF4834R-XFF4834R_chr41800

1

176

S=157 I=30 E=1.53151e-12

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr30170 lcl|XFF4834R_chr32750197_3468231_f1_XFF4834R-XFF4834R_chr30170

12

184

S=150 I=32 E=1.12779e-11

XFF4834R

XFF4834R_chr36520 lcl|XFF4834R_chr39720015_4229941_r3_XFF4834R-XFF4834R_chr36520

8

283

S=149 I=25 E=1.45224e-11

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr27150 lcl|XFF4834R_chr29640031_3129957_f1_XFF4834R-XFF4834R_chr27150

2

129

S=147 I=38 E=2.45035e-11

X.species

YP_365690.1 lcl|XCV3959

1

315

S=1444 I=92 E=6.78664e-168

LysR family transcriptional regulator

X.species

NP_644139.1 lcl|ampR-XAC3833

1

315

S=1442 I=91 E=1.03135e-167

B-lactamase regulatory protein

X.species

NP_639126.1 lcl|ampR-XCC3781

1

283

S=1304 I=89 E=5.52314e-151

B-lactamase regulatory protein

X.species

NP_638387.1 lcl|ampR-XCC3040

1

210

S=316 I=40 E=3.49477e-31

transcriptional activator ampR family

X.species

NP_637975.1 lcl|XCC2627

6

283

S=309 I=35 E=2.23843e-30

transcriptional regulator

X.species

YP_364085.1 lcl|gcvA-XCV2354

6

283

S=303 I=30 E=1.32553e-29

LysR family transcriptional regulator

X.species

lcl|XALc_2440

1

233

S=301 I=37 E=1.87867e-29

putative transcriptional regulator, lysr family transcription regulator protein

X.species

YP_364679.1 lcl|XCV2948

6

283

S=301 I=36 E=2.01439e-29

LysR family transcriptional regulator

X.species

NP_643100.1 lcl|XAC2791-XAC2791

6

283

S=301 I=36 E=2.04982e-29

transcriptional regulator

X.species

YP_365025.1 lcl|ampR-XCV3294

1

210

S=298 I=39 E=4.85937e-29

LysR family transcriptional regulator

pubmed

2

283

S=367 I=38 E=7.95516e-36

Putative transcriptional regulatory protein ; DNA-binding regulation

Pubmed 18263729

 

prodomImg

pubmed

4

283

S=331 I=33 E=1.79941e-31

Glycine cleavage system transcriptional activator ; Cytoplasm DNA-binding Repressor regulation

Pubmed 8188587,7704273

 

prodomImg

pubmed

4

283

S=312 I=33 E=3.67196e-29

GcdR ; DNA-binding Transcription regulation

Pubmed 18177371

 

prodomImg

pubmed

1

283

S=311 I=34 E=5.38895e-29

HTH-type transcriptional activator ampR ; Cytoplasm DNA-binding regulation

Pubmed 8405939

 

prodomImg

pubmed

1

202

S=308 I=40 E=1.24454e-28

AmpR ; DNA-binding Transcription regulation

Pubmed 14693541

 

prodomImg

pubmed

2

248

S=306 I=34 E=1.99287e-28

AmpR transcriptional regulator ; DNA-binding regulation

Pubmed 12654751

 

prodomImg

pubmed

2

249

S=304 I=34 E=3.54315e-28

AmpR of SFO-1 ; DNA-binding Plasmid Transcription regulation

Pubmed 9925524

 

prodomImg

pubmed

5

234

S=298 I=35 E=1.67258e-27

LysR-type beta-lactamase transcriptional regulator ; DNA-binding regulation

Pubmed 9371340

 

prodomImg

pubmed

1

283

S=298 I=31 E=1.67258e-27

HTH-type transcriptional activator ampR ; Cytoplasm DNA-binding regulation

Pubmed 2788410

 

prodomImg

pubmed

5

249

S=296 I=35 E=3.21643e-27

Transcriptional activator AmpR ; DNA-binding regulation

Pubmed 11157909

 

prodomImg

Iprscan IPR011991 [G3DSA:1.10.10.10]

6

90

Winged helix repressor DNA-binding

Iprscan IPR000847 [PF00126]

12

65

HTH transcriptional regulator, LysR

Iprscan IPR005119 [PF03466]

86

288

LysR, substrate-binding

Iprscan IPR000847 [PS50931]

4

61

HTH transcriptional regulator, LysR

Iprscan [seg]

284

307

-

PD897344

214

283

S=349 I=99 E=9.05456e-35

PDA4V1L0

175

283

S=160 I=39 E=7.39621e-12

PDA201L7

175

213

S=159 I=74 E=7.93052e-12

PD735591

125

174

S=123 I=52 E=2.26996e-07

PDA4P8U1

93

204

S=120 I=33 E=4.10677e-07

PD000161

12

69

S=120 I=41 E=5.10696e-07

PDA0L2V9

44

169

S=114 I=27 E=2.19033e-06

PDA219Y6

93

264

S=114 I=29 E=2.28792e-06

PD893511

120

283

S=105 I=24 E=2.96944e-05

PD702880

71

119

S=103 I=42 E=5.37225e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TlKSNbcn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

170 hits
swiss-prot

Swiss-Prot ncbi-blastp

156 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

23 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVLcuzX/XFF4834R_chr37280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVLcuzX/XFF4834R_chr37280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVLcuzX/XFF4834R_chr37280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVLcuzX/XFF4834R_chr37280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.