Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr37160rpoHXFF4834R_chr37160RNA polymerase, sigma 32 (sigma H) factor

rpoH XFF4834R_chr37160
XFF4834R_chr37150
XFF4834R_chr37150
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37170
XFF4834R_chr37170
ID rpoH
AC XFF4834R_chr37160
LT XFF4834R_chr37160
OR XFF4834R_chr from 4298412 to 4299287 on strand -
DE RNA polymerase, sigma 32 (sigma H) factor
IP RNA polymerase sigma-70 region 1.2; RNA polymerase sigma factor RpoH, proteobacteria; RNA polymerase sigma-70
CL 3.1.2.1 Sigma factors, anti-sigmafactors GO:0016987 GO:0016989
EC
GO InterPro
Biological Process: transcription initiation (GO:0006352)
Biological Process: response to heat (GO:0009408)
DNA-dependent (GO:0006355)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: sigma factor activity (GO:0016987)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 32781.8 Da
SQ 291 aa
 
........10........20........30........40........50
| | | | |
MNQTTSTALVANNLPIPSALGSLDAYIGAVHQIPVLSVDEEQDLARRFRD
ELDLDAARELVHSHLRFVVHVARGYNGYGLPLGDLIQEGNIGLMKAVKRF
DPDMGVRLVSFAVHWIRAEMHEFILKNWRIVKVATTKAQRKLFFNLRKSK
TRLGWLNASEVTAVAKDLNVSEREVMEMESRLSGRDIGFDASSDEDDDHG
PPSPVSYLVANEEDPSQAYERHDSEDNQLQLLREGMAGLDARSRDIVKRR
WLDSDSKVTLQELADEYGVSAERIRQIEANALKKMKALFVA
XFF4834R

XFF4834R_chr36800 lcl|rpoD-XFF4834R_chr36800

56

286

S=240 I=30 E=1.11047e-22

RNA polymerase, sigma 70 (sigma D) factor

X.species

NP_644130.1 lcl|rpoH-XAC3824

1

291

S=1532 I=100 E=1.39731e-178

RNA polymerase factor sigma-32

X.species

YP_365680.1 lcl|rpoH-XCV3949

1

291

S=1530 I=100 E=1.99774e-178

RNA polymerase factor sigma-32

X.species

NP_639116.1 lcl|rpoH-XCC3771

1

291

S=1510 I=98 E=5.57983e-176

RNA polymerase factor sigma-32

X.species

lcl|rpoH-XALc_2875

1

291

S=1385 I=89 E=9.05757e-161

probable rna polymerase sigma-32 factor protein

X.species

lcl|rpoD-XALc_2846

24

286

S=246 I=28 E=8.73053e-23

probable rna polymerase sigma-70 factor, rpod protein

X.species

NP_644094.1 lcl|rpoD-XAC3788

56

286

S=240 I=30 E=4.15743e-22

RNA polymerase sigma factor RpoD

X.species

NP_639081.1 lcl|rpoD-XCC3736

56

286

S=240 I=30 E=4.19384e-22

RNA polymerase sigma factor RpoD

X.species

YP_365643.1 lcl|rpoD-XCV3912

56

286

S=240 I=30 E=4.26761e-22

RNA polymerase sigma factor RpoD

pubmed

1

291

S=1510 I=98 E=2.07571e-174

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 9535756

 

prodomImg

pubmed

6

291

S=864 I=59 E=4.04524e-96

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 11320135

 

prodomImg

pubmed

16

286

S=857 I=62 E=2.95303e-95

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 11430412

 

prodomImg

pubmed

12

286

S=845 I=60 E=7.76617e-94

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9168128

 

prodomImg

pubmed

21

286

S=842 I=59 E=1.71703e-93

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 7501460

 

prodomImg

pubmed

11

290

S=840 I=56 E=2.99996e-93

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 16362517

 

prodomImg

pubmed

6

289

S=840 I=58 E=3.63428e-93

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 10492171

 

prodomImg

pubmed

18

287

S=830 I=60 E=5.8147e-92

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2841288,6088062

 

prodomImg

pubmed

13

287

S=823 I=59 E=4.09925e-91

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2664713

 

prodomImg

pubmed

21

286

S=805 I=55 E=5.13367e-89

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9079916

 

prodomImg

sp

12

286

S=845 I=60 E=5.35335e-94

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

 

prodomImg

sp

21

286

S=842 I=59 E=1.18358e-93

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

 

prodomImg

Iprscan IPR000943 [PR00046]

84

97

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

239

251

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

259

274

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

274

285

RNA polymerase sigma-70 factor

Iprscan [G3DSA:1.10.601.10]

25

129

-

Iprscan IPR011991 [G3DSA:1.10.10.10]

221

286

Winged helix repressor DNA-binding

Iprscan IPR007627 [PF04542]

60

130

RNA polymerase sigma-70 region 2

Iprscan IPR007630 [PF04545]

235

287

RNA polymerase sigma-70 region 4

Iprscan IPR014284 [TIGR02937]

55

289

RNA polymerase sigma-70

Iprscan IPR012759 [TIGR02392]

21

291

RNA polymerase sigma factor RpoH, proteobacteria

Iprscan IPR000943 [PS00715]

84

97

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

259

285

RNA polymerase sigma-70 factor

PDA1L1W5

187

226

S=210 I=100 E=6.06943e-18

PDA1K9L6

1

38

S=174 I=84 E=1.31431e-13

PDA1F7Q8

144

191

S=156 I=62 E=2.06476e-11

PD683715

226

286

S=155 I=53 E=2.50134e-11

PD003643

113

143

S=140 I=77 E=1.97338e-09

PDA00051

82

112

S=110 I=65 E=8.01218e-06

Iprscan IPR013324 [SSF88659]

197

289

RNA polymerase sigma factor, region 3/4

Iprscan IPR013325 [SSF88946]

16

130

RNA polymerase sigma factor, region 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LcFccy43)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

335 hits
swiss-prot

Swiss-Prot ncbi-blastp

130 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzt0Lcb/XFF4834R_chr37160.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzt0Lcb/XFF4834R_chr37160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzt0Lcb/XFF4834R_chr37160.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzt0Lcb/XFF4834R_chr37160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.