Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr37010XFF4834R_chr40170511_4282188_f1_XFF4834R-XFF4834R_chr37010XFF4834R_chr37010Conserved hypothetical protein

XFF4834R_chr40170511_4282188_f1_XFF4834R-XFF4834R_chr37010 XFF4834R_chr37010
XFF4834R_chr_3938
XFF4834R_chr_3938
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37020
XFF4834R_chr37020
ID XFF4834R_chr40170511_4282188_f1_XFF4834R-XFF4834R_chr37010
AC XFF4834R_chr37010
LT XFF4834R_chr37010
OR XFF4834R_chr from 4281277 to 4282188 on strand +
DE Conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN modif start pour prendre celui du gene 3938 sans stop qui a ete delete
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20100611)
MW 31838.3 Da
SQ 303 aa
 
........10........20........30........40........50
| | | | |
LAAYLASARPNGSRPQPSGASSPRPCTPFSRPLCGGRTDAHTAAMRTVLT
VLLLAASLPASAATAASKPDPNVRVYRCVSSTGTVALQDAPCSSGRQQVL
DLQRPQDPPPRPARVEPAPVAAASTHEVRIVTVQPPQPMYECTTEDGNRY
TSDSPEGNPRWVPTWGPAYVGNTIAPPVGGGGGGGIQRPPISVNPRPAIS
VQGGSGRGSIRGNASFGVDSYQGGYQGGYNGGGYGGTVVVPYGNVQIRDA
CHALPAQEMCARLADRRWELIRRYNSALQSEREDLSREQRGIEARQQRDC
GGA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vzIT8mRy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2dyINg/XFF4834R_chr37010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2dyINg/XFF4834R_chr37010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2dyINg/XFF4834R_chr37010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2dyINg/XFF4834R_chr37010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.