Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36900XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900XFF4834R_chr36900putative dolichyl-phosphate mannosyltransferase

XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900 XFF4834R_chr36900
XFF4834R_chr36890
XFF4834R_chr36890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36910
XFF4834R_chr36910
ID XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900
AC XFF4834R_chr36900
LT XFF4834R_chr36900
OR XFF4834R_chr from 4267946 to 4269667 on strand -
DE putative dolichyl-phosphate mannosyltransferase
IP Glycosyl transferase, family 39
CL 1.6.11 Glycoprotein GO:0009101
EC
GO InterPro
Biological Process: protein amino acid O-linked glycosylation (GO:0006493)
Cellular Component: membrane (GO:0016020)
Molecular Function: mannosyltransferase activity (GO:0000030)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100818)
MW 64323.5 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MFKNRASTDVWLLAMTAVLVIGAGLGLRDPWPADEPRFALVAKQMVLSGD
WLFPHRGNELYSDKPPMLMWLQAVFYTLLGNWRVAFLLPSLLAALGTLAC
VYDLGRRLWTRRVGVYAAWMLLFTLHFTFQAKKAQIDPLVVFWITLANYG
LLRHLLMGPAWRWWTLGWFAAGLGVITKGVGIIALLMLIPAGIAAARGWP
GVRAHVRDRRFWLGPLFFFVAIALWFVPMMVTALTAGQSEYRVYLNDILL
RQTAKRYASSWDHAQPVWYHLQSMATMWLPTILLLPWAIPAWRRRLKRRD
PRYLLPLAWWLLVLVFFTIPSGKRDVYILPALPMFCLALAPLAPGLLRRA
GVQRLLFGFGLLLAVVFCAGGAAMLIGHPGFEQKIMDSRGVGSEATDPLG
WLLLAVGTWGIASLLLMRVRRSALAVVSLLGAWWVAFGLVCYPIFNDSSS
AGAVMREAGRRIGPDAQLGLVAWKEQNLLMADRPAQTFGFKVPWETQLQR
GVAWQAEQPDQRWLMAQETALLACVDRSRSQLVGVANRRRWWLVPADAVR
GPCVASSSERAVEAKEQGNLDTE
XFF4834R

XFF4834R_chr33200 lcl|XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200

24

571

S=855 I=38 E=9.18974e-97

X.species

YP_365654.1 lcl|XCV3923

1

573

S=2522 I=87 E=0

putative dolichyl-phosphate mannosyltransferase

X.species

NP_644104.1 lcl|XAC3798-XAC3798

1

573

S=2486 I=86 E=0

hypothetical protein

X.species

NP_639091.2 lcl|XCC3746

1

573

S=2352 I=79 E=0

hypothetical protein

X.species

lcl|XALc_2855

1

567

S=1568 I=59 E=0

putative glycosyltransferase protein

X.species

NP_636494.2 lcl|XCC1119

24

573

S=906 I=40 E=1.80693e-102

hypothetical protein

X.species

YP_362983.1 lcl|XCV1252

15

571

S=897 I=39 E=2.34517e-101

putative glycosyltransferase

X.species

NP_641556.2 lcl|XAC1220-XAC1220

24

571

S=832 I=38 E=1.88971e-93

hypothetical protein

pubmed

27

571

S=838 I=38 E=1.35667e-92

Putative uncharacterized protein ; Cell membrane

Pubmed 15195943

 

prodomImg

pubmed

12

332

S=152 I=25 E=1.99191e-09

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosy

Pubmed 15583148

 

prodomImg

pubmed

5

332

S=152 I=26 E=2.04469e-09

Melittin resistance protein ; Cell membrane

Pubmed 17241198,17993540

 

prodomImg

pubmed

1

332

S=150 I=24 E=3.24574e-09

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosy

Pubmed 14973084

 

prodomImg

pubmed

12

333

S=149 I=25 E=4.76342e-09

Glycosyltransferase, family 39 Putative transmembrane protein ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

sp

31

332

S=173 I=27 E=4.18459e-12

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

 

prodomImg

sp

25

332

S=170 I=27 E=8.62845e-12

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthe

 

prodomImg

sp

25

286

S=165 I=27 E=3.5428e-11

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

 

prodomImg

sp

26

286

S=163 I=28 E=6.93278e-11

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

 

prodomImg

sp

1

330

S=154 I=25 E=7.62424e-10

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthe

 

prodomImg

Iprscan IPR003342 [PF02366]

61

233

Glycosyl transferase, family 39

Iprscan [seg]

85

99

-

Iprscan [seg]

293

315

-

Iprscan [seg]

337

351

-

Iprscan [seg]

355

363

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [tmhmm]

10

27

-

Iprscan [tmhmm]

79

98

-

Iprscan [tmhmm]

108

127

-

Iprscan [tmhmm]

139

158

-

Iprscan [tmhmm]

168

190

-

Iprscan [tmhmm]

211

233

-

Iprscan [tmhmm]

268

290

-

Iprscan [tmhmm]

303

322

-

Iprscan [tmhmm]

326

348

-

Iprscan [tmhmm]

355

377

-

Iprscan [tmhmm]

399

416

-

Iprscan [tmhmm]

423

445

-

PDA1I4B9

443

566

S=456 I=71 E=1.17453e-47

PD605865

154

274

S=370 I=59 E=2.78541e-37

PD572086

316

442

S=186 I=43 E=6.0462e-15

PDA1H2I1

27

64

S=170 I=79 E=5.3893e-13

PDA2P423

1

26

S=126 I=100 E=9.54175e-08

PDA271E7

443

553

S=109 I=30 E=1.20542e-05

PDA522Z5

1

26

S=104 I=85 E=4.53615e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iurnguCG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

72 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBaNFrA/XFF4834R_chr36900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBaNFrA/XFF4834R_chr36900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBaNFrA/XFF4834R_chr36900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBaNFrA/XFF4834R_chr36900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.