Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36800rpoDXFF4834R_chr36800RNA polymerase, sigma 70 (sigma D) factor

rpoD XFF4834R_chr36800
XFF4834R_chr36790
XFF4834R_chr36790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36810
XFF4834R_chr36810
ID rpoD
AC XFF4834R_chr36800
LT XFF4834R_chr36800
OR XFF4834R_chr from 4256671 to 4258548 on strand -
DE RNA polymerase, sigma 70 (sigma D) factor
IP RNA polymerase sigma factor 70, region 1.1; RNA polymerase sigma factor RpoD, C-terminal; RNA polymerase sigma-70; RNA polymerase sporulation-specific sigma factor, SigK/SigE
CL 3.1.2.1 Sigma factors, anti-sigmafactors GO:0016987 GO:0016989
EC
GO InterPro
Biological Process: transcription initiation (GO:0006352)
Biological Process: regulation of transcription (GO:0045449)
DNA-dependent (GO:0006355)
Molecular Function: sigma factor activity (GO:0016987)
Molecular Function: transcription regulator activity (GO:0030528)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 70069.7 Da
SQ 625 aa
 
........10........20........30........40........50
| | | | |
MANERPAQQSDIKLLISKGLEQGYLTYAEVNDHLPDDLVDPEQIEDIISM
INGMGIDVHEVAPDAETLLLNDGNTGNREVDDTAAEEAAAALTALDTEGG
RTTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGVFPLSTE
MLLADYEAHKEGKKRLAEIVVGFNDLIEEADAAAAALAAAGPVAVSDDEA
VDEDDDEDGDDDAAEEEAGPTGPDPVEVATRMENLANEYAKFKKVYAKNG
AEHKLVVKAREDMAAIFTTLKLPLPLTDALVTQLRGVVNGIKDHERKVLH
LATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQKWSSALRDVKDQIIS
EQQGSIEMEKANYLTLGEIKEISRAMAYGEAKARKAKKEMVEANLRLVIS
IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAI
TRSIADQARTIRIPVHMIETINKLNRISRQMLQQFGREATPEELAKEMDM
PEDKIRKVMKIAKEPISMETPIGDDEDSHLGDFIEDTNVESPIDNTTNIN
LSETVRDVLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQ
IEAKALRKLRHPSRSEQLRSFLDID
XFF4834R

XFF4834R_chr37160 lcl|rpoH-XFF4834R_chr37160

386

610

S=240 I=30 E=2.94478e-22

RNA polymerase, sigma 32 (sigma H) factor

XFF4834R

XFF4834R_chr20630 lcl|fliA-XFF4834R_chr20630

381

610

S=109 I=28 E=1.99724e-06

RNA polymerase, sigma 28 (sigma F) factor

X.species

NP_644094.1 lcl|rpoD-XAC3788

1

625

S=2980 I=92 E=0

RNA polymerase sigma factor RpoD

X.species

YP_365643.1 lcl|rpoD-XCV3912

1

625

S=2975 I=92 E=0

RNA polymerase sigma factor RpoD

X.species

NP_639081.1 lcl|rpoD-XCC3736

1

625

S=2892 I=90 E=0

RNA polymerase sigma factor RpoD

X.species

lcl|rpoD-XALc_2846

1

625

S=2690 I=83 E=0

probable rna polymerase sigma-70 factor, rpod protein

X.species

lcl|rpoH-XALc_2875

370

610

S=241 I=29 E=9.37701e-22

probable rna polymerase sigma-32 factor protein

X.species

NP_644130.1 lcl|rpoH-XAC3824

386

610

S=240 I=30 E=1.12611e-21

RNA polymerase factor sigma-32

X.species

YP_365680.1 lcl|rpoH-XCV3949

386

610

S=240 I=30 E=1.16608e-21

RNA polymerase factor sigma-32

X.species

NP_639116.1 lcl|rpoH-XCC3771

386

610

S=238 I=30 E=1.88358e-21

RNA polymerase factor sigma-32

X.species

lcl|fliA-XALc_1379

375

610

S=121 I=28 E=3.03355e-07

probable rna polymerase sigma factor for flagellar operon (sigma-f factor) protein

X.species

YP_363708.1 lcl|fliA-XCV1977

381

610

S=110 I=28 E=6.76001e-06

RNA polymerase sigma factor for flagellar operon FliA

pubmed

243

625

S=1933 I=96 E=0

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

1

147

S=656 I=86 E=1.60633e-70

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

8

623

S=1826 I=60 E=0

RNA polymerase sigma factor ; DNA-binding DNA-directed Transcription regulation

Pubmed 9434175

 

prodomImg

pubmed

8

623

S=1764 I=59 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 7665535

 

prodomImg

pubmed

9

623

S=1754 I=58 E=0

RNA polymerase sigma-70 subunit ; DNA-binding factor Transcription regulation

Pubmed 15262936

 

prodomImg

pubmed

9

623

S=1737 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 1398077

 

prodomImg

pubmed

9

623

S=1733 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 3005129

 

prodomImg

pubmed

9

623

S=1713 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 11272828

 

prodomImg

pubmed

9

623

S=1710 I=57 E=0

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 7557408,6269063

 

prodomImg

pubmed

9

623

S=1709 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 6269063

 

prodomImg

Iprscan [coil]

327

348

-

Iprscan [coil]

584

605

-

Iprscan [G3DSA:1.10.601.10]

118

459

-

Iprscan IPR011991 [G3DSA:1.10.10.10]

463

514

Winged helix repressor DNA-binding

Iprscan IPR011991 [G3DSA:1.10.10.10]

544

622

Winged helix repressor DNA-binding

Iprscan IPR007127 [PF03979]

4

89

RNA polymerase sigma factor 70, region 1.1

Iprscan IPR009042 [PF00140]

103

139

RNA polymerase sigma-70 region 1.2

Iprscan IPR007631 [PF04546]

145

359

RNA polymerase sigma factor 70, non-essential region

Iprscan IPR007627 [PF04542]

390

460

RNA polymerase sigma-70 region 2

Iprscan IPR007624 [PF04539]

464

546

RNA polymerase sigma-70 region 3

Iprscan IPR007630 [PF04545]

558

611

RNA polymerase sigma-70 region 4

Iprscan IPR014284 [TIGR02937]

385

613

RNA polymerase sigma-70

Iprscan IPR012760 [TIGR02393]

386

623

RNA polymerase sigma factor RpoD, C-terminal

Iprscan IPR000943 [PS00715]

414

427

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

583

609

RNA polymerase sigma-70 factor

Iprscan [seg]

81

98

-

Iprscan [seg]

180

190

-

Iprscan [seg]

197

218

-

PD004871

231

366

S=234 I=38 E=1.01257e-20

PDA1L052

136

179

S=219 I=95 E=6.2038e-19

PD996759

469

514

S=194 I=80 E=6.52061e-16

PD002240

13

56

S=184 I=80 E=1.04327e-14

PD944436

444

542

S=167 I=34 E=1.08794e-12

PD861393

587

624

S=167 I=84 E=1.16653e-12

PD003138

100

136

S=152 I=84 E=7.4007e-11

PD751488

444

541

S=146 I=30 E=4.49862e-10

PDA43826

443

542

S=138 I=28 E=4.34081e-09

PDA00051

414

443

S=136 I=87 E=7.71756e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cl1mbY0M)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

584 hits
swiss-prot

Swiss-Prot ncbi-blastp

164 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

26 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiL_sWT/XFF4834R_chr36800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiL_sWT/XFF4834R_chr36800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiL_sWT/XFF4834R_chr36800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiL_sWT/XFF4834R_chr36800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.