Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36750XFF4834R_chr39930545_4253673_f1_XFF4834R-XFF4834R_chr36750XFF4834R_chr36750Conserved hypothetical protein

XFF4834R_chr39930545_4253673_f1_XFF4834R-XFF4834R_chr36750 XFF4834R_chr36750
XFF4834R_chr_3912
XFF4834R_chr_3912
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36760
XFF4834R_chr36760
ID XFF4834R_chr39930545_4253673_f1_XFF4834R-XFF4834R_chr36750
AC XFF4834R_chr36750
LT XFF4834R_chr36750
OR XFF4834R_chr from 4253269 to 4253673 on strand +
DE Conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN matrice ACUR, modification du start (la nouvelle orf contient le gene 3912 qui a donc ete delete), orthologue chez xantho aurantifolii et des fragments homologues chez xantho vasculorum
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20100611)
MW 14214.9 Da
SQ 134 aa
 
........10........20........30........40........50
| | | | |
MGEVQAKVRLRDGGAQMFGKELGFGARQREALAGDGEVDVVSHDCARGWV
AGIWAAIQASTSDSSQTVTRGESGMDLGNRSRSISQYRWDREMPVRLSTS
GLRKKRSLRPASGRGALAGVPGKAAGVVREASIV
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G6rNu3l0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPv71RH/XFF4834R_chr36750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPv71RH/XFF4834R_chr36750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPv71RH/XFF4834R_chr36750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPv71RH/XFF4834R_chr36750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.