Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36690XFF4834R_chr_4245072_4245224_r2_XFF4834R-XFF4834R_chr36690XFF4834R_chr36690Hypothetical protein

XFF4834R_chr_4245072_4245224_r2_XFF4834R-XFF4834R_chr36690 XFF4834R_chr36690
XFF4834R_chr36690
XFF4834R_chr36690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3907
XFF4834R_chr_3907
ID XFF4834R_chr_4245072_4245224_r2_XFF4834R-XFF4834R_chr36690
AC XFF4834R_chr36690
LT XFF4834R_chr36690
OR XFF4834R_chr from 4245072 to 4245914 on strand -
DE Hypothetical protein
IP
CL 10 cryptic genes
EC
GO InterPro


Curated
PM
AN ACUR prediction. The end of the CDS and the downstream sequence correspond to the PCR fragment (SCAR) described by Toth as specific of the fuscous strains of phaseoli. Position of primers XF1 and XF2 are 4244719 to 4244739 and 4245195 to 4245173, respectively.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120314)
MW 30442.1 Da
SQ 280 aa
 
........10........20........30........40........50
| | | | |
MKCAGVAGRRLRAAGLTGELRTLSLTPRSQARSHPLSNRMNGISMVQFAF
LAIASTAAKVASSSAPWWGSLLQLAGTLAGSLGGVWVGAHLVARREQLAR
EQKRSADALYLAVTVSGILERFTADCADVAGDDGTYRGGVAEWGLAIQVQ
SPSLDYASLEVVWMALPGQLLDQVHSVPRKLENIQRYLDFMGDNGDDDRY
FADRQRKFAELGLHAAATSIALRTHVGLQEMIDSESSTVEWLKEKLSERI
RIDKAYDEQQAALWNTLAPPASTENVQQSS
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tNAvA9lH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsL5Zig/XFF4834R_chr36690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsL5Zig/XFF4834R_chr36690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsL5Zig/XFF4834R_chr36690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsL5Zig/XFF4834R_chr36690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.