Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35860lrpXFF4834R_chr35860AsnC family leucine-responsive regulatory protein

lrp XFF4834R_chr35860
XFF4834R_chr35850
XFF4834R_chr35850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35870
XFF4834R_chr35870
ID lrp
AC XFF4834R_chr35860
LT XFF4834R_chr35860
OR XFF4834R_chr from 4156753 to 4157232 on strand +
DE AsnC family leucine-responsive regulatory protein
IP HTH transcriptional regulator, MarR; Transcription regulator AsnC-type
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: sequence-specific DNA binding (GO:0043565)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 18223.9 Da
SQ 159 aa
 
........10........20........30........40........50
| | | | |
MSTRARELDKIDRKILRILQQEGRISFTELGERVGLSTTPCTERVRRLER
DGAITGYYARLDPHYLKASLLVFVEISLAYKSGDIFEEFRRAALKLPNVL
ECHLVSGDFDYLLKARISEMASYRKLLGSTLLTMPHVRESKSYIVMEEVK
ETLALPIAD
XFF4834R

XFF4834R_chr00790 lcl|XFF4834R_chr_0094319_0094930_r3_XFF4834R-XFF4834R_chr00790

8

158

S=231 I=34 E=6.25832e-22

XFF4834R

XFF4834R_chr25260 lcl|XFF4834R_chr27600836_2914267_r3_XFF4834R-XFF4834R_chr25260

12

112

S=127 I=31 E=2.31136e-09

X.species

YP_365541.1 lcl|lrp-XCV3810

1

159

S=820 I=100 E=1.03386e-92

AsnC family leucine-responsive regulatory protein

X.species

NP_643996.1 lcl|lrp-XAC3689

1

159

S=814 I=99 E=5.4662e-92

leucine responsive regulatory protein

X.species

NP_638995.1 lcl|lrp-XCC3649

1

157

S=799 I=98 E=3.75094e-90

leucine responsive regulatory protein

X.species

NP_635552.1 lcl|XCC0157

8

158

S=231 I=34 E=2.56457e-21

AsnC family transcriptional regulator

X.species

YP_361889.1 lcl|XCV0158

8

158

S=230 I=34 E=3.36044e-21

AsnC family transcriptional regulator

X.species

NP_640531.1 lcl|XAC0175-XAC0175

8

158

S=230 I=34 E=3.36044e-21

AsnC family transcriptional regulator

X.species

lcl|XALc_0055

23

157

S=202 I=35 E=8.3732e-18

putative transcriptional regulator, asnc family protein

X.species

NP_642830.1 lcl|XAC2515-XAC2515

12

112

S=139 I=32 E=3.63306e-10

AsnC/Lrp family transcriptional regulator

X.species

YP_364428.1 lcl|XCV2697

12

112

S=129 I=31 E=5.66267e-09

AsnC family transcriptional regulator

X.species

lcl|XALc_1932

12

112

S=118 I=29 E=1.19756e-07

putative transcriptional regulator transcription regulator protein

pubmed

1

153

S=788 I=100 E=2.53225e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=788 I=100 E=2.53225e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=788 I=100 E=2.53225e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=788 I=100 E=2.53225e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=788 I=100 E=2.53225e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=785 I=99 E=5.17606e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=783 I=99 E=9.28315e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=783 I=99 E=9.28315e-87

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=782 I=99 E=1.14438e-86

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

pubmed

1

153

S=781 I=99 E=1.5259e-86

Leucine-responsive regulatory protein ; DNA-binding Transcription regulation

Pubmed 15023955

 

prodomImg

Iprscan IPR000485 [PR00033]

8

24

Transcription regulator, AsnC-type, HTH domain

Iprscan IPR000485 [PR00033]

24

35

Transcription regulator, AsnC-type, HTH domain

Iprscan IPR000485 [PR00033]

35

54

Transcription regulator, AsnC-type, HTH domain

Iprscan [G3DSA:3.30.70.920]

60

158

-

Iprscan IPR011991 [G3DSA:1.10.10.10]

8

59

Winged helix repressor DNA-binding

Iprscan IPR019887 [PF01037]

72

148

Transcription regulator, AsnC-type, C-terminal

Iprscan IPR000835 [PF01047]

14

55

HTH transcriptional regulator, MarR

Iprscan IPR019888 [SM00344]

8

117

Transcription regulator, AsnC-type

Iprscan IPR019885 [PS00519]

26

52

Transcription regulator, AsnC-type, HTH domain, conserved site

Iprscan IPR000485 [PS50956]

8

81

Transcription regulator, AsnC-type, HTH domain

PD161972

97

150

S=137 I=48 E=3.44237e-09

PD879079

58

96

S=128 I=67 E=5.27271e-08

PD773958

8

54

S=126 I=49 E=7.21686e-08

PD799415

14

57

S=116 I=45 E=1.35087e-06

PDA1D9T0

57

157

S=106 I=25 E=2.03337e-05

PD000857

25

57

S=105 I=61 E=3.11714e-05

Iprscan [SSF46785]

8

67

-

Iprscan IPR011008 [SSF54909]

68

157

Dimeric alpha-beta barrel

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one w0MQE4In)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

73 hits
swiss-prot

Swiss-Prot ncbi-blastp

52 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJcBvIS/XFF4834R_chr35860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJcBvIS/XFF4834R_chr35860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJcBvIS/XFF4834R_chr35860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJcBvIS/XFF4834R_chr35860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.