Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35690XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690XFF4834R_chr35690putative sensory/regulatory hybrid protein of a two component system

XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690 XFF4834R_chr35690
XFF4834R_chr35680
XFF4834R_chr35680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35700
XFF4834R_chr35700
ID XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690
AC XFF4834R_chr35690
LT XFF4834R_chr35690
OR XFF4834R_chr from 4140286 to 4142022 on strand +
DE putative sensory/regulatory hybrid protein of a two component system
IP Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region; Signal transduction histidine kinase, hybrid-type, BC3207, predicted
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)

Curated
PM
AN
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101020)
MW 62845.5 Da
SQ 578 aa
 
........10........20........30........40........50
| | | | |
MRSTPNRAAPGLILAARQLRNDRLVRLFESFLEYRACVGRVIVQTIVTAW
CLGWLYGPQPVLVADAHHVFPTALSLWLLSVVWMLLVRRRIIPPSEWLDA
MGFAMNLLFIGIQTYLAFILLMSLNAFLPFITIAAVARYGQRAIFPVLLS
TFVLMLLTAPSGYWLSRPAYFVYAVALIIVLPLLVARIVLAMQEVALQAL
ALRDAQSRFISTMSHELRTPLNAVINCAQLIETEQMPAQQRELLQSVTVN
ATALRHRVNEVLDVASIDGGRLQLHRKPLNLLDVVTTVKAVCATVASSKG
VTLDVRVDSPQAPHVMGDEGRIEQVISNLVINAIKFTPAGGTVDLLIDAT
QVQERWSIAVTVTDTGIGVPDDQKAYIFTPFTQLSTGFSRVEGGVGLGLY
IALSVSDAMGGSLTVSDNPAGGSIFRWIFELPGAAAGSTTLALRDALAQH
AQNVPSLHCLVFEDMDTNRLVIGNLLTRAGHRVSFQVDGTDAVQRIREAA
PDLVFLDLHMPGTSGWDALREARDAMSALPPIIVLTADTRTDSMRDASAA
GVAGYLPKPINAHELLALLAQHASHARP
XFF4834R

XFF4834R_chr20180 lcl|XFF4834R_chr21680335_2316515_f3_XFF4834R-XFF4834R_chr20180

124

560

S=502 I=30 E=5.40023e-54

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

205

535

S=371 I=32 E=4.10217e-38

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

451

561

S=129 I=34 E=8.47492e-09

XFF4834R

XFF4834R_chr09040 lcl|XFF4834R_chr09630140_1044050_r2_XFF4834R-XFF4834R_chr09040

205

561

S=365 I=32 E=1.75938e-37

XFF4834R

XFF4834R_chr16090 lcl|XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

205

561

S=365 I=30 E=1.95343e-37

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

206

561

S=346 I=30 E=3.68543e-35

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

205

432

S=342 I=35 E=1.21686e-34

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

453

560

S=121 I=34 E=6.24088e-08

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

198

561

S=315 I=29 E=2.50283e-31

XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

193

560

S=289 I=32 E=3.60061e-28

X.species

NP_643980.1 lcl|XAC3673-XAC3673

1

578

S=2603 I=87 E=0

histidine kinase

X.species

YP_365524.1 lcl|XCV3793

1

561

S=2599 I=89 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

NP_642204.1 lcl|rpfC-XAC1878

138

560

S=523 I=33 E=5.17816e-56

RpfC protein

X.species

YP_363650.1 lcl|rpfC-XCV1919

124

560

S=505 I=30 E=9.03206e-54

sensory/regulatory protein RpfC

X.species

NP_637221.1 lcl|rpfC-XCC1856

124

560

S=485 I=32 E=1.94211e-51

RpfC protein

X.species

lcl|rpfC-XALc_1346

130

560

S=477 I=30 E=1.94049e-50

probable regulation of pathogenicity factor rpfc protein

X.species

YP_364402.1 lcl|XCV2671

205

535

S=376 I=33 E=3.89284e-38

two-component system sensor histidine kinase-response regulator hybridprotein

X.species

YP_364402.1 lcl|XCV2671

451

561

S=129 I=34 E=3.10668e-08

two-component system sensor histidine kinase-response regulator hybridprotein

X.species

NP_643340.1 lcl|XAC3031-XAC3031

205

561

S=375 I=30 E=4.13782e-38

histidine kinase-response regulator hybrid protein

X.species

YP_364899.1 lcl|XCV3168

205

561

S=372 I=30 E=1.10827e-37

two-component system sensor histidine kinase-response regulator hybrid protein

pubmed

124

560

S=485 I=32 E=9.4391e-50

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

124

560

S=484 I=32 E=9.85968e-50

Sensory/regulatory protein rpfC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transcription regulation

Pubmed 1645442

 

prodomImg

pubmed

124

560

S=475 I=29 E=1.45845e-48

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

130

560

S=459 I=30 E=1.17086e-46

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

205

560

S=441 I=33 E=2.04228e-44

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 18487337

 

prodomImg

pubmed

205

560

S=430 I=30 E=3.69178e-43

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 19182778

 

prodomImg

pubmed

205

560

S=429 I=30 E=5.14189e-43

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 19182778

 

prodomImg

pubmed

205

560

S=428 I=30 E=5.91162e-43

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 19182778

 

prodomImg

pubmed

205

560

S=427 I=30 E=8.16221e-43

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Transferase Two-component regulatory system

Pubmed 19182778

 

prodomImg

pubmed

205

560

S=422 I=30 E=3.44018e-42

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 19182778

 

prodomImg

Iprscan IPR003594 [G3DSA:3.30.565.10]

272

433

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

444

575

-

Iprscan IPR003661 [PF00512]

205

270

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

317

432

ATP-binding region, ATPase-like

Iprscan IPR001789 [PF00072]

459

570

Signal transduction response regulator, receiver region

Iprscan IPR003661 [SM00388]

205

270

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

317

433

ATP-binding region, ATPase-like

Iprscan IPR001789 [SM00448]

457

569

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

212

433

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

458

573

Signal transduction response regulator, receiver region

Iprscan [seg]

74

90

-

Iprscan [seg]

172

191

-

Iprscan [seg]

284

296

-

Iprscan [seg]

562

576

-

Iprscan [tmhmm]

36

58

-

Iprscan [tmhmm]

68

87

-

Iprscan [tmhmm]

100

122

-

Iprscan [tmhmm]

142

164

-

Iprscan [tmhmm]

169

191

-

PD658519

27

207

S=668 I=74 E=2.04595e-73

PDA1B8I1

379

459

S=404 I=96 E=1.90702e-41

PD419285

325

423

S=163 I=42 E=3.77177e-12

PD969272

269

439

S=126 I=26 E=1.14754e-07

PD464419

203

422

S=124 I=24 E=1.86987e-07

PDA3D0B2

1

26

S=122 I=96 E=3.38294e-07

PD431966

197

343

S=105 I=24 E=3.31891e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DtDGFMQg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

341 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

62 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

19 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUPwKy4/XFF4834R_chr35690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUPwKy4/XFF4834R_chr35690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUPwKy4/XFF4834R_chr35690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUPwKy4/XFF4834R_chr35690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.