Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35270cohBXFF4834R_chr35270Probable copper homeostasis protein B

cohB XFF4834R_chr35270
XFF4834R_chr35260
XFF4834R_chr35260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3750
XFF4834R_chr_3750
ID cohB
AC XFF4834R_chr35270
LT XFF4834R_chr35270
OR XFF4834R_chr from 4096768 to 4097856 on strand +
DE Probable copper homeostasis protein B
IP Copper resistance B precursor
CL 5.6.4 Drug resistance/sensitivity GO:0042493
EC
GO InterPro
Biological Process: cellular copper ion homeostasis (GO:0006878)
Cellular Component: cell outer membrane (GO:0009279)
Molecular Function: copper ion binding (GO:0005507)

Curated
PM
AN For copper homeostasis, see the paper on Xanthomonas pathogenic on tomato and pepper (Potnis et al 2011, BMC Genomics 12). There are 3 genes in this copper homeostasis cluster cohL, A and B. These genes are often misinterpretated with cop genes that are plasmidic copper resistance genes. Level of copper resistance conferrred by cop genes is higher than by coh genes. cop and coh genes in Xv share 27 to 65 % id.
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120313)
MW 40016 Da
SQ 362 aa
 
........10........20........30........40........50
| | | | |
MSRFCMQAWFAAAFLASASAVAQEHRHDAMEEVPQDMQEHALQVTDGAHE
TPASSQAAPMDHAHMSHAEMCTNAMDHEPMKHGSMDDAAIHHQAMDHAWM
DHSKMHHAPPTHAAQAPASPTETRSRPSTPIPPPTADDIAAAFAPLHTHT
MHSAGINHYVLLDRLEASNTDRGSGQAWESRAWIGGDIDRLWLRSEGERH
DGRTESASLEAFYGHAISPWWDVLVGARQDIGAGEHRSWAAFGVQGLAPY
KFETEATLYVGNGSRAALRLEGEYEVLLTNRLILQPRAEADIALTDDDRR
GIGSGLEQVELGLRLRYEITRRFAPYIGWVHSRSFGDSAQRAAMDDAPAR
DSRFVAGVRVWF
Show or not Domain decomposition
 
X.species

NP_643938.1 copB-XAC3631

1

362

S=1434 I=78 E=1.26848e-166

copper resistance protein B precursor

X.species

YP_365479.1 copB-XCV3748

1

362

S=1392 I=76 E=1.55721e-161

copper resistance protein B

X.species

NP_635968.1 copB-XCC0576

146

362

S=958 I=81 E=5.96406e-109

copper resistance protein B precursor

pubmed

149

362

S=669 I=57 E=2.39431e-72

Juglandis copper-resistance genes,

Pubmed 8282694

 

prodomImg

pubmed

149

362

S=665 I=58 E=8.18611e-72

CopB

Pubmed 15920618

 

prodomImg

pubmed

149

362

S=650 I=55 E=4.88594e-70

Copper resistance protein B ; Cell membrane outer Plasmid Repeat Signal

Pubmed 3372485,1924351

 

prodomImg

pubmed

151

362

S=621 I=55 E=1.52719e-66

CopB-like protein

Pubmed 15691931

 

prodomImg

pubmed

146

362

S=590 I=51 E=8.78804e-63

Copper resistance protein B ; Cell membrane outer Plasmid Signal

Pubmed 8594334

 

prodomImg

sp

149

362

S=650 I=55 E=3.3255e-70

Copper resistance protein B ; Cell membrane outer Plasmid Repeat Signal

 

prodomImg

sp

146

362

S=590 I=51 E=5.98137e-63

Copper resistance protein B ; Cell membrane outer Plasmid Signal

 

prodomImg

sp

149

362

S=567 I=50 E=4.39729e-60

Copper resistance protein B homolog ; Cell membrane outer Signal

 

prodomImg

Iprscan IPR007939 [PF05275]

156

362

Copper resistance B precursor

Iprscan [seg]

8

22

-

Iprscan [seg]

106

145

-

Iprscan [SignalP-NN(euk)]

1

22

-

PD024328

241

362

S=375 I=61 E=6.89687e-38

PDA1G1U8

160

242

S=241 I=56 E=9.07411e-22

PDA122L1

23

56

S=144 I=79 E=6.33857e-10

PDA947C0

178

362

S=139 I=26 E=2.12969e-09

PD669978

174

362

S=133 I=25 E=1.19686e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OARBRpmA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp05wCM/XFF4834R_chr35270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp05wCM/XFF4834R_chr35270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp05wCM/XFF4834R_chr35270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp05wCM/XFF4834R_chr35270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.