Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35260cohAXFF4834R_chr35260Probable Copper homeostasis Protein A

cohA XFF4834R_chr35260
XFF4834R_chr35250
XFF4834R_chr35250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35270
XFF4834R_chr35270
ID cohA
AC XFF4834R_chr35260
LT XFF4834R_chr35260
OR XFF4834R_chr from 4094990 to 4096771 on strand +
DE Probable Copper homeostasis Protein A
IP Copper-resistance protein CopA; Cupredoxin
CL 5.6.4 Drug resistance/sensitivity GO:0042493
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: periplasmic space (GO:0042597)
Molecular Function: copper ion binding (GO:0005507)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN For copper homeostasis, see the paper on Xanthomonas pathogenic on tomato and pepper (Potnis et al 2011, BMC Genomics 12). There are 3 genes in this copper homeostasis cluster cohL, A and B. These genes are often misinterpretated with cop genes that are plasmidic copper resistance genes. Level of copper resistance conferrred by cop genes is higher than by coh genes. cop and coh genes in Xv share 27 to 65 % id.
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120313)
MW 65749.9 Da
SQ 593 aa
 
........10........20........30........40........50
| | | | |
MSFDPPFSHGSTASGLSRRRFVQGLALGGIAASGLWRNDARAAAQANTPV
LRGSSQSLQIGRLPVNFTGRPRSAITVNQSLPAPTLRWREGDTVSVRVRN
ALTDQPTSVHWHGLLLPANMDGVPGMSFDGIAPGQEYHYRFALRQSGTYW
YHSHSMFQEQSGLYGAIVIDPLTPPPYRHDREHLVLLSDWTDLDPAALFR
RLKQMPSHDNYAQRTVGDFLRDARDDGLRATLADRGMWGRMRMTPTDLSD
VNANTYTYLLNGVAPAGNWTGLFKPGEKVLLRFINGSSMTYFNIRIPGLR
MTVVAADGQYVHPVSVDELRIAAAETFDVIVEPLGQDAFTLFAQDMGRTG
FACGTLAVQHGLQAPIPALDPRAILTMQDMGHGDGMDHALPAMHGAPGML
AAHGMHTMHSHDDAKAHDKAPHHSASETGNPLIDMRSNATAPRLDDPGVG
LRDNGRRVLCYADLHSVFDDPDGREPGRDIELHLTGHMEKFAWSFDGIAF
ASAQPLRLQYGERLRIVLVNDTMMQHPIHLHGMWSDLEDAHGNFQVRKHT
IDMPPGTRRTYRVRADALGRWAYHCHLLYHMEAGMMREVRVEA
X.species

NP_643937.1 lcl|copA-XAC3630

1

593

S=3061 I=97 E=0

copper resistance protein A precursor

X.species

YP_365478.1 lcl|copA-XCV3747

1

593

S=2965 I=95 E=0

copper resistance protein A

X.species

NP_635969.1 lcl|copA-XCC0577

1

593

S=2618 I=84 E=0

copper resistance protein A precursor

pubmed

17

592

S=2008 I=65 E=0

Putative multicopper oxidase

Pubmed 15691931

 

prodomImg

pubmed

17

592

S=1836 I=62 E=0

Multicopper oxidase

Pubmed 12354238

 

prodomImg

pubmed

17

592

S=1829 I=59 E=0

Potential multicopper oxidase

Pubmed 12354238

 

prodomImg

pubmed

17

592

S=1829 I=59 E=0

Copper resistance protein A ; Metal-binding Oxidoreductase Periplasm Plasmid Repeat Signal

Pubmed 8594334

 

prodomImg

pubmed

17

592

S=1828 I=60 E=0

Copper resistance protein A ; Metal-binding Oxidoreductase Periplasm Plasmid Repeat Signal

Pubmed 3372485,1924351

 

prodomImg

pubmed

14

592

S=1737 I=60 E=0

CopA

Pubmed 15920618

 

prodomImg

pubmed

11

592

S=1734 I=59 E=0

Copper resitance protein Multicopper oxidase

Pubmed 12354238

 

prodomImg

pubmed

41

591

S=1516 I=53 E=1.02734e-174

Copper resistance transmembrane protein Copper-resistance protein CopA ; Plasmid Signal

Pubmed 7766206,11544228

 

prodomImg

pubmed

41

591

S=1508 I=53 E=1.00874e-173

CopA protein

Pubmed 11544228

 

prodomImg

pubmed

1

388

S=1339 I=66 E=2.58846e-153

Juglandis copper-resistance genes,

Pubmed 8282694

 

prodomImg

sp

17

592

S=1856 I=61 E=0

Copper resistance protein A homolog ; Metal-binding Oxidoreductase Periplasm Repeat Signal

 

prodomImg

sp

17

592

S=1829 I=59 E=0

Copper resistance protein A ; Metal-binding Oxidoreductase Periplasm Plasmid Repeat Signal

 

prodomImg

sp

17

592

S=1828 I=60 E=0

Copper resistance protein A ; Metal-binding Oxidoreductase Periplasm Plasmid Repeat Signal

 

prodomImg

sp

77

331

S=258 I=28 E=1.66901e-22

L-ascorbate oxidase EC=1.10.3.3 ; Copper Disulfide bond Glycoprotein Metal-binding Oxidoreductase Repeat Secreted Signal

 

prodomImg

sp

77

331

S=254 I=27 E=5.4629e-22

L-ascorbate oxidase EC=1.10.3.3 ; Copper Disulfide bond Glycoprotein Metal-binding Oxidoreductase Repeat Secreted Signal

 

prodomImg

PD442314

206

276

S=270 I=66 E=3.82706e-25

PD662096

372

439

S=210 I=65 E=8.05316e-18

PD904870

443

489

S=208 I=83 E=1.34701e-17

PDA1V439

204

233

S=154 I=100 E=4.16332e-11

PD662125

90

189

S=139 I=32 E=3.172e-09

PDA204J1

533

561

S=138 I=83 E=3.77627e-09

PD260856

274

338

S=120 I=48 E=5.25079e-07

PD989287

78

151

S=120 I=36 E=6.52961e-07

PD409514

489

532

S=116 I=48 E=1.67429e-06

PDA1G2H8

339

371

S=116 I=64 E=1.84281e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one q6fvAa8t)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

323 hits
swiss-prot

Swiss-Prot ncbi-blastp

103 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6MzwcL/XFF4834R_chr35260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6MzwcL/XFF4834R_chr35260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6MzwcL/XFF4834R_chr35260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6MzwcL/XFF4834R_chr35260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.