Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35040rhlE2XFF4834R_chr35040Probable ATP-dependent RNA helicase rhlE

rhlE2 XFF4834R_chr35040
XFF4834R_chr35030
XFF4834R_chr35030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3723
XFF4834R_chr_3723
ID rhlE2
AC XFF4834R_chr35040
LT XFF4834R_chr35040
OR XFF4834R_chr from 4067119 to 4068501 on strand +
DE Probable ATP-dependent RNA helicase rhlE
IP DNA/RNA helicase, C-terminal; DEAD-like helicase, N-terminal; RNA helicase, DEAD-box type, Q motif
CL 2.2.3 RNA modification GO:0009451
EC
GO InterPro
Molecular Function: ATP-dependent helicase activity (GO:0008026)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: helicase activity (GO:0004386)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [JKL] Translation, ribosomal structure and biogenesis;Transcription;Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130522)
MW 50087.9 Da
SQ 460 aa
 
........10........20........30........40........50
| | | | |
MSFESLGLAPFLLRALAEQGYETPTPIQQQAIPLVLAGHDLLAGAQTGTG
KTAAFGLPLLQHLGTAPQTVNGPRKPRALILTPTRELATQVHDSLRGYSK
YLRIPSAVIYGGVGMGNQLDALRRGVDLLIACPGRLIDHIERRSVDLSGI
EVLILDEADRMLDMGFLPSIKRILTKLPRQDRQTLLFSATFEENIKQLAL
EFMRNPMQIQVTPSNTVAESITHRVHPVDGARKRDLLLHLLAQDSREQTL
VFARTKHGSDKLALFLEKSGIKTAAIHGNKSQGQRMRALSDFKAGRVTVL
VATDIAARGIDIDQLPKVINYDLPMVAEDYVHRIGRTGRNGSTGEAISLV
AQDEAKLLRQIVRMLGRDVEIRDVPGYEPQTPIRWGNSAPGRAEQPGGDR
APRKIHARRPHGDAPRQAHAHAGPKKPGGQRSNGPRQANTGAGAGRRDGG
RGGQRPSGTR
XFF4834R

XFF4834R_chr04340 lcl|XFF4834R_chr04500585_0498877_r3_XFF4834R-XFF4834R_chr04340

1

410

S=804 I=46 E=8.70781e-91

XFF4834R

XFF4834R_chr18150 lcl|deaD-XFF4834R_chr18150

3

378

S=705 I=40 E=9.65565e-79

ATP-dependent RNA helicase

XFF4834R

XFF4834R_chr37210 lcl|rhlB-XFF4834R_chr37210

1

374

S=649 I=38 E=6.59817e-72

ATP-dependent RNA helicase

XFF4834R

XFF4834R_chr24010 lcl|dbpA-XFF4834R_chr24010

3

354

S=528 I=37 E=2.60856e-57

ATP-dependent RNA helicase, specific for 23S rRNA

XFF4834R

XFF4834R_chr12600 lcl|recG-XFF4834R_chr12600

263

360

S=111 I=27 E=8.85746e-07

ATP-dependent DNA helicase

XFF4834R

XFF4834R_chr24340 lcl|lhr-XFF4834R_chr24340

241

346

S=107 I=35 E=2.82432e-06

predicted ATP-dependent helicase

XFF4834R

XFF4834R_chr15080 lcl|recQ-XFF4834R_chr15080

126

362

S=100 I=25 E=2.13493e-05

ATP-dependent DNA helicase

XFF4834R

XFF4834R_chr04340 lcl|XFF4834R_chr04500585_0498877_r3_XFF4834R-XFF4834R_chr04340

1

410

S=804 I=46 E=8.70781e-91

XFF4834R

XFF4834R_chr18150 lcl|deaD-XFF4834R_chr18150

3

378

S=705 I=40 E=9.65565e-79

ATP-dependent RNA helicase

XFF4834R

XFF4834R_chr37210 lcl|rhlB-XFF4834R_chr37210

1

374

S=649 I=38 E=6.59817e-72

ATP-dependent RNA helicase

X.species

NP_643917.1 lcl|rhlE-XAC3610

1

440

S=2198 I=96 E=0

ATP-dependent RNA helicase

X.species

YP_365464.1 lcl|rhlE-XCV3733

1

439

S=2188 I=96 E=0

ATP-dependent RNA helicase

X.species

NP_635982.1 lcl|rhlE-XCC0590

1

439

S=2170 I=95 E=0

ATP-dependent RNA helicase

X.species

lcl|rhlE-XALc_2720

1

434

S=1830 I=81 E=0

probable atp-dependent rna helicase protein

X.species

NP_640797.1 lcl|rhlE-XAC0442

1

428

S=813 I=45 E=2.95718e-91

ATP-dependent RNA helicase

X.species

lcl|deaD-XALc_2052

3

378

S=735 I=42 E=7.39577e-82

probable atp-dependent rna helicase (cold-shock dead box protein)

X.species

YP_362201.1 lcl|rhlE-XCV0470

5

428

S=716 I=43 E=1.89322e-79

ATP-dependent RNA helicase

X.species

NP_643122.1 lcl|deaD-XAC2813

3

378

S=702 I=39 E=8.85216e-78

ATP-dependent RNA helicase

X.species

NP_635819.1 lcl|rhlE-XCC0425

5

384

S=701 I=44 E=1.08178e-77

ATP-dependent RNA helicase

X.species

NP_637990.1 lcl|deaD-XCC2642

3

378

S=699 I=39 E=1.95714e-77

ATP-dependent RNA helicase

pubmed

1

384

S=1105 I=57 E=4.17912e-125

Putative ATP-dependent RNA helicase rhlE EC=3.6.1.- ; ATP-binding Hydrolase Nucleotide-binding RNA-binding

Pubmed 8037924

 

prodomImg

pubmed

1

401

S=1036 I=56 E=1.16142e-116

RhlE ; ATP-binding Helicase Hydrolase Nucleotide-binding

Pubmed 12055289

 

prodomImg

pubmed

1

202

S=937 I=92 E=1.07238e-104

Putative ATP-dependent RNA helicase ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 11589581

 

prodomImg

pubmed

1

376

S=933 I=51 E=3.36031e-104

RNA helicase ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 10074063

 

prodomImg

pubmed

1

433

S=830 I=41 E=1.00673e-91

Putative ATP-dependent RNA helicase ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 14566056

 

prodomImg

pubmed

1

404

S=809 I=43 E=3.06804e-89

RhlE protein ; ATP-binding Helicase Hydrolase Nucleotide-binding

Pubmed 9642210

 

prodomImg

pubmed

1

312

S=789 I=50 E=9.93833e-87

ATP-dependent RNA helicase ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 12571000

 

prodomImg

pubmed

2

369

S=766 I=44 E=5.47952e-84

ATP-dependent RNA helicase EC=3.6.1.- ; ATP-binding Hydrolase Nucleotide-binding

Pubmed 18459973

 

prodomImg

pubmed

2

377

S=730 I=40 E=1.306e-79

Vasa-like protein ; ATP-binding Helicase Hydrolase Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 14985097

 

prodomImg

pubmed

2

377

S=723 I=41 E=9.9586e-79

Vasa-like protein ; ATP-binding Helicase Hydrolase Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 18489004

 

prodomImg

sp

1

384

S=1105 I=57 E=2.87612e-125

Putative ATP-dependent RNA helicase rhlE EC=3.6.1.- ; ATP-binding Hydrolase Nucleotide-binding RNA-binding

 

prodomImg

sp

3

365

S=749 I=42 E=4.80575e-82

ATP-dependent RNA helicase DED1 EC=3.6.1.- ; ATP-binding Cytoplasm Hydrolase Initiation factor Nucleotide-binding Protein biosynthesis RNA-binding

 

prodomImg

sp

2

365

S=724 I=40 E=5.09541e-79

ATP-dependent RNA helicase DBP2 EC=3.6.1.- ; ATP-binding Cytoplasm Hydrolase Nonsense-mediated mRNA decay Nucleotide-binding Nucleus Ribosome biogenes

 

prodomImg

sp

2

395

S=721 I=39 E=1.23995e-78

Cold-shock DEAD box protein A homolog EC=3.6.1.- ; ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding RNA-binding Transcription regulation

 

prodomImg

sp

3

389

S=719 I=40 E=2.1664e-78

DEAD-box ATP-dependent RNA helicase 52A EC=3.6.1.- ; ATP-binding Hydrolase Nucleotide-binding RNA-binding

 

prodomImg

PD275462

362

438

S=268 I=66 E=6.28748e-25

PD622927

183

365

S=169 I=25 E=5.55776e-13

PD000276

128

183

S=155 I=50 E=3.04022e-11

PD324530

76

300

S=146 I=24 E=3.55386e-10

PD901737

299

371

S=145 I=43 E=5.64137e-10

PD000033

234

309

S=138 I=46 E=3.77436e-09

PDA1W2Q1

75

206

S=138 I=30 E=3.84075e-09

PD952087

57

204

S=132 I=27 E=2.13972e-08

PDA900X1

248

378

S=129 I=25 E=4.81396e-08

PD322377

2

42

S=126 I=59 E=1.01008e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one srSTiMRe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCJ9p1_/XFF4834R_chr35040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCJ9p1_/XFF4834R_chr35040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCJ9p1_/XFF4834R_chr35040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCJ9p1_/XFF4834R_chr35040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.