Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35030XFF4834R_chr38200752_4066885_r3_XFF4834R-XFF4834R_chr35030XFF4834R_chr35030fumarylacetoacetate hydrolase family protein

XFF4834R_chr38200752_4066885_r3_XFF4834R-XFF4834R_chr35030 XFF4834R_chr35030
XFF4834R_chr35020
XFF4834R_chr35020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35040
XFF4834R_chr35040
ID XFF4834R_chr38200752_4066885_r3_XFF4834R-XFF4834R_chr35030
AC XFF4834R_chr35030
LT XFF4834R_chr35030
OR XFF4834R_chr from 4065752 to 4066741 on strand -
DE fumarylacetoacetate hydrolase family protein
IP Fumarylacetoacetase, C-terminal-like
CL 1 Metabolism GO:0008152
EC
    GO InterPro
    Biological Process: metabolic process (GO:0008152)
    Molecular Function: catalytic activity (GO:0003824)

    Curated
    PM
    AN
    CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
    CC MODEL: XFF4834R
    CC STATUS: curated by cociancich (20100416)
    MW 35233.4 Da
    SQ 329 aa
     
    ........10........20........30........40........50
    | | | | |
    MKLGSLKEGGRDGCLVVVARDLRTAVRATGIAPTLQRALEDWSNVAPRLN
    ALSASLNDGSADGVFDLDVQALAAPLPRAYEFVDGSAYLPHVERVRRARN
    AEVPESFYTDPLMYQATSAGFYGPRDAIKVISEDYGIDLEAEIVVVTDDV
    PMGASPEQAAAHIQLVGLVNDVSLRNLIPAELAKGFGFVQSKPRSALSPV
    FVTPDELDDAWRDSKLHLPLVTHVNGAWFGAPEAGNDMQFDFAQLIAHAA
    KTRPLSAGTIVGSGTIANQDTTLGASCFAEQRVVETLRDGKPSSPFMAFG
    DVVRIEMFDAGGASIFGAIEQRVERQPLP
    XFF4834R

    XFF4834R_chr40570 lcl|XFF4834R_chr_4691057_4691914_f2_XFF4834R-XFF4834R_chr40570

    111

    265

    S=129 I=27 E=3.47839e-09

    XFF4834R

    XFF4834R_chr40570 lcl|XFF4834R_chr_4691057_4691914_f2_XFF4834R-XFF4834R_chr40570

    111

    265

    S=129 I=27 E=3.47839e-09

    X.species

    NP_643916.2 lcl|uptA-XAC3609

    1

    329

    S=1642 I=96 E=0

    fumarylacetoacetate hydrolase

    X.species

    YP_365463.1 lcl|uptA-XCV3732

    1

    329

    S=1611 I=93 E=0

    fumarylacetoacetate hydrolase family protein

    X.species

    NP_635983.1 lcl|uptA-XCC0591

    1

    329

    S=1548 I=89 E=1.87898e-180

    fumarylacetoacetate hydrolase

    X.species

    lcl|uptA-XALc_2719

    1

    329

    S=1386 I=78 E=7.86305e-161

    probable fumarylacetoacetase protein

    X.species

    YP_366016.1 lcl|XCV4285

    111

    265

    S=134 I=27 E=3.24368e-09

    2-hydroxyhepta-2,4-diene-1,7-dioate isomerase

    X.species

    NP_644486.1 lcl|XAC4187-XAC4187

    111

    265

    S=134 I=27 E=3.3588e-09

    2-hydroxyhepta-2,4-diene-1, 7-dioateisomerase/5-carboxymethyl-2-oxo-hex-3-ene-1, 7-dioatedecarboxylase

    X.species

    lcl|XALc_0447

    111

    265

    S=133 I=27 E=4.28752e-09

    putative 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase protein

    X.species

    NP_639407.1 lcl|XCC4068

    111

    265

    S=126 I=26 E=3.21284e-08

    2-hydroxyhepta-2,4-diene-1, 7-dioateisomerase/5- carboxymethyl-2-oxo-hex-3-ene-1, 7-dioatedecarboxylase

    pubmed

    1

    329

    S=1548 I=89 E=7.08743e-179

    Fumarylacetoacetate hydrolase Putative dioxygenase

    Pubmed 11589581

     

    prodomImg

    pubmed

    1

    325

    S=843 I=53 E=1.53798e-93

    Putative uncharacterized protein

    Pubmed 10220173

     

    prodomImg

    pubmed

    105

    268

    S=154 I=29 E=5.21498e-10

    DitH

    Pubmed 10188280,10217753

     

    prodomImg

    PD350991

    1

    323

    S=1074 I=64 E=1.14644e-122

    Show or not Suggestions

    Suggest an annotation

    Move your mouse over each field to get more informations

    ID
    DE
    EC
    GO
    PM
    CC
    CL
      Your email
      Validation code (copy this one 4GfmB2iW)
       

    Show or not Access unfiltered results

    pubmed

    Set of Uniprot with relevant PubMed cross-references ncbi-blastp

    3 hits
    swiss-prot

    Swiss-Prot ncbi-blastp

    0 hits
    XFF4834R

    Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

    2 hits
    hamap

    HAMAP scan

    0 hits
    Interpro Scan

    IprScan

    0 hits

    Show or not Miscellaneous analyses

    • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuDeBtu/XFF4834R_chr35030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
    • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuDeBtu/XFF4834R_chr35030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
    • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuDeBtu/XFF4834R_chr35030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
    • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuDeBtu/XFF4834R_chr35030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.