Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35020XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020XFF4834R_chr35020putative maleylacetoacetate isomerase

XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020 XFF4834R_chr35020
XFF4834R_chr35010
XFF4834R_chr35010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35030
XFF4834R_chr35030
ID XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020
AC XFF4834R_chr35020
LT XFF4834R_chr35020
OR XFF4834R_chr from 4065057 to 4065719 on strand -
DE putative maleylacetoacetate isomerase
IP Maleylacetoacetate isomerase; Glutathione S-transferase, C-terminal-like; Thioredoxin fold; Glutathione S-transferase/chloride channel, C-terminal
CL 1.1.3.15 Phenylalanine, tyrosine degradation GO:0006559 GO:0006572
EC
GO InterPro
Biological Process: aromatic amino acid family metabolic process (GO:0009072)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN XCC and XAC homologues were named uptB on the basis of a paper on Xcc B100, however this name is not used anymore in Xcc B100
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110315)
MW 24556.9 Da
SQ 220 aa
 
........10........20........30........40........50
| | | | |
MSAALELFSYWRSSAAYRVRIGLGLKALDYIAHPVHLVRDGGEQHAPAYA
QLNPQELVPTLRHGAVVIAQSLAILEYLEEAFADTTALLPRAPEERARVR
ALAQLIACDVHPLNNLRVLQALEREFALEGAQRQQWTRLWMARGFTALET
QLARDAQTGRFCHGDVPGLADCVLIPQLYNAHRFEVDLVPYPTLRRIEQA
CLQLPAFDAARPEMQADAVA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr37110 lcl|XFF4834R_chr40290220_4294876_r3_XFF4834R-XFF4834R_chr37110

42

83

S=92 I=45 E=6.84656e-05

predicted glutathione S-transferase

X.species

NP_643915.1 lcl|uptB-XAC3608

1

220

S=992 I=87 E=2.12801e-113

maleylacetoacetate isomerase

X.species

YP_365462.1 lcl|XCV3731

1

220

S=981 I=87 E=5.1741e-112

maleylacetoacetate isomerase

X.species

NP_635984.1 lcl|uptB-XCC0592

1

218

S=800 I=72 E=4.22999e-90

maleylacetoacetate isomerase

X.species

lcl|uptB-XALc_2718

1

218

S=666 I=61 E=7.4857e-74

probable maleylacetoacetate isomerase protein

X.species

NP_644125.1 lcl|gst-XAC3819

42

83

S=97 I=48 E=7.25383e-05

glutathione S-transferase

pubmed

1

218

S=818 I=73 E=1.09292e-90

Putative maleylacetoacetate isomerase EC=5.2.1.2

Pubmed 11589581

 

prodomImg

pubmed

5

218

S=440 I=42 E=6.68356e-45

Maleylpyruvate isomerase ; Plasmid

Pubmed 9573207,11133965

 

prodomImg

pubmed

5

220

S=413 I=41 E=1.31604e-41

Putative glutathione-S-transferase

Pubmed 11682182,12635929

 

prodomImg

pubmed

5

219

S=401 I=42 E=3.11723e-40

Maleylpyruvate isomerase

Pubmed 15782938

 

prodomImg

pubmed

7

218

S=399 I=41 E=5.39907e-40

Glutathione transferase, zeta class (AGAP002898-PA) Glutathione S-transferase

Pubmed 12914673

 

prodomImg

pubmed

7

220

S=390 I=40 E=7.00731e-39

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Transferase Tyrosine

Pubmed 10373324

 

prodomImg

pubmed

5

220

S=388 I=43 E=1.24583e-38

Maleylacetoacetate isomerase

Pubmed 15262943

 

prodomImg

pubmed

7

218

S=381 I=41 E=1.00977e-37

Glutathione transferase zeta 1

Pubmed 19088266

 

prodomImg

pubmed

7

218

S=377 I=40 E=2.56672e-37

Glutathione S-transferase zeta

Pubmed 18676034

 

prodomImg

pubmed

7

218

S=375 I=41 E=4.56338e-37

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Polymorphism Transferase Tyrosine

Pubmed 9417084,9396740

 

prodomImg

sp

4

218

S=454 I=44 E=8.97387e-47

Probable maleylacetoacetate isomerase EC=5.2.1.2 ; Phenylalanine catabolism Tyrosine

 

prodomImg

sp

5

220

S=402 I=44 E=1.97413e-40

Maleylacetoacetate isomerase EC=5.2.1.2 ; Phenylalanine catabolism Tyrosine

 

prodomImg

sp

7

218

S=397 I=39 E=6.69093e-40

Probable maleylacetoacetate isomerase 2 EC=5.2.1.2 ; Alternative splicing Cytoplasm Phenylalanine catabolism Tyrosine

 

prodomImg

sp

7

220

S=390 I=40 E=4.84198e-39

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Transferase Tyrosine

 

prodomImg

sp

7

218

S=375 I=41 E=3.15325e-37

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Polymorphism Transferase Tyrosine

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

5

83

Thioredoxin fold

Iprscan IPR010987 [G3DSA:1.20.1050.10]

89

217

Glutathione S-transferase, C-terminal-like

Iprscan IPR004045 [PF02798]

3

80

Glutathione S-transferase, N-terminal

Iprscan IPR005955 [TIGR01262]

6

219

Maleylacetoacetate isomerase

Iprscan IPR004045 [PS50404]

3

86

Glutathione S-transferase, N-terminal

Iprscan IPR017933 [PS50405]

92

218

Glutathione S-transferase/chloride channel, C-terminal

Iprscan [seg]

89

103

-

PDA931O3

4

218

S=220 I=35 E=3.65186e-19

PD995502

104

153

S=150 I=52 E=1.16682e-10

PDA739S8

165

217

S=139 I=51 E=1.96712e-09

PD632657

157

192

S=135 I=61 E=7.46736e-09

PDA6S9P1

6

41

S=130 I=72 E=2.90979e-08

PDA1F8T8

5

30

S=111 I=73 E=5.07543e-06

PDA1R328

193

218

S=109 I=85 E=1.10274e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NJwk6ZGc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBATP6WU/XFF4834R_chr35020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBATP6WU/XFF4834R_chr35020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBATP6WU/XFF4834R_chr35020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBATP6WU/XFF4834R_chr35020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.