Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34990XFF4834R_chr38180121_4063011_r1_XFF4834R-XFF4834R_chr34990XFF4834R_chr34990putative outer membrane protein

XFF4834R_chr38180121_4063011_r1_XFF4834R-XFF4834R_chr34990 XFF4834R_chr34990
XFF4834R_chr_3716
XFF4834R_chr_3716
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35000
XFF4834R_chr35000
ID XFF4834R_chr38180121_4063011_r1_XFF4834R-XFF4834R_chr34990
AC XFF4834R_chr34990
LT XFF4834R_chr34990
OR XFF4834R_chr from 4062121 to 4063011 on strand -
DE putative outer membrane protein
IP Outer membrane protein, OmpA/MotB, C-terminal
CL 6.1 Membrane GO:0009274
EC
GO InterPro
Cellular Component: cell outer membrane (GO:0009279)

Curated
PM
AN OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. This entry represents domain with a beta/alpha/beta/alpha-beta(2) structure found in the C-terminal region of many Gram-negative bacterial outer membrane proteins PUBMED:1538702, such as porin-like integral membrane proteins (such as ompA) PUBMED:2202726, small lipid-anchored proteins (such as pal) PUBMED:10515919, and MotB proton channels PUBMED:17052729. The N-terminal half is variable although some of the proteins in this group have the OmpA-like transmembrane domain at the N terminus. OmpA from Escherichia coli is required for pathogenesis, and can interact with host receptor molecules PUBMED:17368067. MotB (and MotA) serves two functions in E. coli, the MotA(4)-MotB(2) complex attaches to the cell wall via MotB to form the stator of the flagellar motor, and the MotA-MotB complex couples the flow of ions across the cell membrane to movement of the rotor PUBMED:17052729.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100812)
MW 31485.3 Da
SQ 296 aa
 
........10........20........30........40........50
| | | | |
MTLRPLLYLGVLSLVTLPPLAMAAKDDPQADALNRRLAALQNDPQTNDLA
RFERLQAQQSVAALAEAKRRDRDELVFLADRRVEIAELTARTALARRELD
RLEGTRNDLLIEASRRDAARARQEAERLRVQAQIQTEAAEQARQAAEQEA
LARQDAELALTSVAGKQTAKLNAAQQKAVQLAHEEAELVAGAKLPAVKFD
SRGEVFSLGSGAFGGKAALSGDAAGQAKALAEYLNIGKKGRVSIVGFDTD
AAIARKRAEAVRDALVAGGVSASRLQVSGTKGAVSKARAAEVVVAP
X.species

NP_643912.1 lcl|uptE-XAC3605

18

296

S=943 I=73 E=2.92769e-107

outer membrane protein

X.species

YP_365459.1 lcl|uptE-XCV3728

18

296

S=941 I=73 E=5.53274e-107

outer membrane protein UptE

X.species

NP_635987.1 lcl|uptE-XCC0595

18

296

S=797 I=65 E=1.53946e-89

outer membrane protein

X.species

lcl|XALc_2715

24

296

S=532 I=49 E=2.18063e-57

conserved hypothetical protein

pubmed

18

296

S=803 I=65 E=1.33287e-88

Putative outer membrane protein UptE ; Signal

Pubmed 11589581

 

prodomImg

Iprscan [coil]

85

106

-

Iprscan [coil]

111

150

-

Iprscan IPR006665 [PF00691]

215

280

Outer membrane protein, OmpA/MotB, C-terminal

Iprscan [seg]

3

17

-

Iprscan [seg]

84

103

-

Iprscan [seg]

112

160

-

Iprscan [SignalP-NN(euk)]

1

23

-

PD318452

187

278

S=356 I=82 E=1.34656e-35

PDA1L5I6

29

111

S=200 I=66 E=9.27019e-17

PDA1R813

161

186

S=122 I=100 E=2.93379e-07

Iprscan IPR006665 [SSF103088]

215

294

Outer membrane protein, OmpA/MotB, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ASTDHDx1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByHrHZe/XFF4834R_chr34990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByHrHZe/XFF4834R_chr34990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByHrHZe/XFF4834R_chr34990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByHrHZe/XFF4834R_chr34990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.