Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34970XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970XFF4834R_chr34970putative cystathionine beta-synthase

XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970 XFF4834R_chr34970
XFF4834R_chr34970
XFF4834R_chr34970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3715
XFF4834R_chr_3715
ID XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970
AC XFF4834R_chr34970
LT XFF4834R_chr34970
OR XFF4834R_chr from 4059942 to 4061312 on strand -
DE putative cystathionine beta-synthase
IP Cystathionine beta-synthase
CL 1.5.1.12 Cysteine GO:0019344
EC
GO InterPro
Biological Process: cysteine biosynthetic process from serine (GO:0006535)
Biological Process: metabolic process (GO:0008152)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN gene is named uptG in Xcc
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 49716.3 Da
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MAIHSSVLELIGNTPIVKAQRLDTGVCELFLKLEANNPGGSIKDRIGLSM
IEAAERRGDLKPGATLVEGTAGNTGLGLALVAQQKGYQLILVVPDKMSRE
KIFNLKAMGANVVLTRSDVAKGHPEYYQDLAARIAAETPGAYFINQFGNP
DNPAAHEFGTGPEILAQMDGRLDAIVFGCGSSGTMTGLSRAFASASPHTE
LVLADPVGSILTQYIEEGTVSEKSGSWLVEGIGEDFLPDISDFSRVKKAY
SISDAESFHTARELLAKEGILGGSSTGTLLAAALKYCREQTTPKRVLVFV
CDTGNKYLSKMYNDYWMLDNGFLERPQHGDLRDLILRPYNKRDTVVVGPK
DLLTTAYQRMKLYDVSQLPVIDDGELVGIVDESDVLLHVYGDEARFRDPI
STAMVSKLDRLDVASPIEALLPVFDRGQVAIVMDGTQFLGLITRIDLLNY
LRRRVQ
XFF4834R

XFF4834R_chr13080 cysK-XFF4834R_chr13080

1

309

S=358 I=32 E=1.0986e-36

cysteine synthase

XFF4834R

XFF4834R_chr35240 XFF4834R_chr38460231_4094334_r1_XFF4834R-XFF4834R_chr35240

28

316

S=125 I=23 E=1.77951e-08

Putative cysteine synthase

X.species

NP_643910.1 cysB-XAC3603

1

456

S=2247 I=94 E=0

cystathionine beta-synthase

X.species

YP_365457.1 XCV3726

1

456

S=2233 I=93 E=0

cystathionine beta-synthase

X.species

NP_635989.1 cysB-XCC0597

1

456

S=2204 I=92 E=0

cystathionine beta-synthase

X.species

XALc_2713 XALc_2713

1

456

S=2057 I=85 E=0

probable cystathionine beta-synthase protein

X.species

YP_365190.1 cysK-XCV3459

1

309

S=363 I=32 E=1.08994e-36

cysteine synthase

X.species

NP_643648.1 cysK-XAC3341

1

309

S=362 I=32 E=1.4407e-36

cysteine synthase

X.species

XALc_2522 cysK-XALc_2522

1

309

S=357 I=32 E=5.42152e-36

probable cysteine synthase protein

X.species

NP_638528.1 cysK-XCC3182

1

309

S=352 I=32 E=2.32524e-35

cysteine synthase

X.species

XALc_2730 cysK-XALc_2730

28

321

S=149 I=24 E=7.39506e-11

probable cysteine synthase protein

X.species

YP_365476.1 XCV3745

28

316

S=123 I=23 E=1.08258e-07

putative cysteine synthase

X.species

NP_643935.1 cysM-XAC3628

28

316

S=121 I=23 E=1.89146e-07

cysteine synthase

X.species

NP_635971.1 cysM-XCC0578

28

318

S=118 I=22 E=5.43204e-07

cysteine synthase

pubmed

1

456

S=2203 I=92 E=0

Cystathionine beta-lyase EC=4.4.1.8

Pubmed 11589581

 

prodomImg

pubmed

1

455

S=1232 I=53 E=2.23287e-140

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Transferase

Pubmed 16885444

 

prodomImg

pubmed

1

451

S=651 I=36 E=6.26311e-70

Cystathionine beta-synthase

Pubmed 12101301

 

prodomImg

pubmed

102

322

S=609 I=56 E=6.92492e-65

Putative uncharacterized protein ; Pyridoxal phosphate

Pubmed 8469144,7808389

 

prodomImg

pubmed

1

451

S=588 I=35 E=2.34315e-62

Probable cystathionine beta-synthase

Pubmed 12375103

 

prodomImg

sp

7

433

S=593 I=35 E=3.5364e-63

Cystathionine beta-synthase EC=4.2.1.22 ; Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond

 

prodomImg

sp

3

456

S=582 I=33 E=9.54685e-62

Cystathionine beta-synthase EC=4.2.1.22 ; Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond Lyase Metal-binding Nucleus Phosphoprote

 

prodomImg

sp

7

433

S=577 I=34 E=3.68781e-61

Cystathionine beta-synthase EC=4.2.1.22 ; Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond Lyase

 

prodomImg

sp

3

456

S=576 I=32 E=4.74873e-61

Cystathionine beta-synthase EC=4.2.1.22 ; Amino-acid biosynthesis CBS domain Cysteine Lyase Pyridoxal phosphate Repeat

 

prodomImg

sp

7

451

S=571 I=33 E=1.85043e-60

Cystathionine beta-synthase EC=4.2.1.22 ; Allosteric enzyme Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Disease mu

 

prodomImg

Iprscan [G3DSA:3.40.50.1100]

120

311

-

Iprscan [PTHR10314:SF8]

27

324

-

Iprscan [PTHR10314]

27

324

-

Iprscan IPR001926 [PF00291]

9

302

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan IPR000644 [PF00571]

343

389

Cystathionine beta-synthase, core

Iprscan IPR000644 [SM00116]

343

390

Cystathionine beta-synthase, core

Iprscan IPR001216 [PS00901]

32

50

Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site

Iprscan IPR000644 [PS51371]

339

396

Cystathionine beta-synthase, core

Iprscan [seg]

69

80

-

Iprscan [seg]

271

284

-

PDA0P8O3

190

260

S=275 I=75 E=7.74251e-26

PD476350

396

455

S=260 I=83 E=5.22112e-24

PDA1F6I9

1

64

S=183 I=54 E=1.13576e-14

PDA099J9

342

395

S=178 I=63 E=5.13275e-14

PDA1H9Y1

99

129

S=150 I=90 E=1.18241e-10

PDA1K436

315

341

S=139 I=81 E=2.41489e-09

PD002454

130

176

S=127 I=55 E=6.63391e-08

PDA2A738

310

341

S=114 I=63 E=2.51618e-06

PDA7L7K5

97

131

S=113 I=60 E=3.85728e-06

PD599081

309

398

S=106 I=29 E=2.91575e-05

Iprscan IPR001926 [SSF53686]

2

323

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan [SSF54631]

330

392

-

Iprscan [SSF54631]

394

451

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ABw0Xpy3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

132 hits
swiss-prot

Swiss-Prot ncbi-blastp

89 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYeFl7b/XFF4834R_chr34970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYeFl7b/XFF4834R_chr34970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYeFl7b/XFF4834R_chr34970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYeFl7b/XFF4834R_chr34970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.