Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34960XFF4834R_chr_4058666_4059853_r3_XFF4834R-XFF4834R_chr34960XFF4834R_chr34960Cys/Met metabolism PLP-dependent enzyme

XFF4834R_chr_4058666_4059853_r3_XFF4834R-XFF4834R_chr34960 XFF4834R_chr34960
XFF4834R_chr34950
XFF4834R_chr34950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34970
XFF4834R_chr34970
ID XFF4834R_chr_4058666_4059853_r3_XFF4834R-XFF4834R_chr34960
AC XFF4834R_chr34960
LT XFF4834R_chr34960
OR XFF4834R_chr from 4058666 to 4059853 on strand -
DE Cys/Met metabolism PLP-dependent enzyme
IP Cys/Met metabolism, pyridoxal phosphate-dependent enzyme
CL 1 Metabolism GO:0008152
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN old name in Xcc B100 was uptH, this name is not used anuymore in Xcc B100, a recent paper calls it metB which is the E. coli name. there are two homologs of metB in Xapf genome (chr_1714 has a better homolgy with metB). in consequence no name is given for this gene.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110315)
MW 42476 Da
SQ 395 aa
 
........10........20........30........40........50
| | | | |
MSNRTTHSHDGERALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSGP
GEHQGFEYSRTHNPTRFAYERCVAALEGGTRAFAFASGMAATSTVMELLD
ADSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVDLTDPAAFEAAIRPDT
KMVWIETPTNPMLKLVDIAAIAEIARKRGLLIVVDNTFASPMLQRPLSLG
ADIIVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFD
SFLALRGLKTLPLRMRAHCENALVLAQWLETHPAIEKVIYPGLASHPQHA
LAKSQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHP
AVMTHASIPVARRDQLGISDALVRLSVGIEDVEDLRGDLERALAR
XFF4834R

XFF4834R_chr16010 metB-XFF4834R_chr16010

18

395

S=848 I=47 E=3.91442e-96

cystathionine gamma-synthase

X.species

NP_643909.1 metB-XAC3602

1

394

S=2049 I=98 E=0

cystathionine gamma-lyase-like protein

X.species

YP_365456.1 XCV3725

1

395

S=1990 I=97 E=0

Cys/Met metabolism PLP-dependent enzyme

X.species

NP_635990.1 metB-XCC0598

1

393

S=1933 I=94 E=0

cystathionine gamma-lyase-like protein

X.species

XALc_2712 XALc_2712

1

393

S=1822 I=85 E=0

probable cys/met metabolism plp-dependent enzyme protein

X.species

XALc_2185 metC-XALc_2185

8

395

S=878 I=46 E=3.7457e-99

putative cystathionine beta-lyases/cystathionine gamma-synthases protein

X.species

NP_643348.1 metB-XAC3039

18

395

S=851 I=47 E=6.64285e-96

cystathionine gamma-synthase

X.species

NP_638204.1 metB-XCC2856

16

395

S=849 I=48 E=9.41488e-96

cystathionine gamma-synthase

X.species

YP_364907.1 metB-XCV3176

18

395

S=844 I=47 E=4.9778e-95

cystathionine gamma-synthase

X.species

NP_638415.1 metB-XCC3068

19

224

S=391 I=45 E=3.56562e-40

homocysteine synthase

X.species

NP_638415.1 metB-XCC3068

238

393

S=310 I=42 E=2.00625e-30

homocysteine synthase

X.species

XALc_2367 XALc_2367

182

393

S=291 I=34 E=4.50615e-28

putative o-acetylhomoserine sulfhydrylase protein

X.species

XALc_2367 XALc_2367

19

232

S=279 I=36 E=1.23788e-26

putative o-acetylhomoserine sulfhydrylase protein

pubmed

1

393

S=1936 I=94 E=0

Cystathionine gamma-synthase EC=2.5.1.48 ; Pyridoxal phosphate Transferase

Pubmed 11589581

 

prodomImg

pubmed

10

393

S=1387 I=63 E=2.90602e-159

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 17088354

 

prodomImg

pubmed

19

394

S=1267 I=63 E=1.13891e-144

Putative uncharacterized protein ; Pyridoxal phosphate

Pubmed 8469144,7808389

 

prodomImg

pubmed

16

393

S=1243 I=62 E=8.01569e-142

Cystathionine-gamma-lyase ; Pyridoxal phosphate

Pubmed 16885444

 

prodomImg

pubmed

15

395

S=1088 I=55 E=6.021e-123

Cystathionine gamma-synthase EC=2.5.1.48 ; Pyridoxal phosphate Transferase

Pubmed 17981822

 

prodomImg

sp

10

393

S=1387 I=63 E=1.8987e-159

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

 

prodomImg

sp

17

395

S=1086 I=54 E=5.77341e-123

Cystathionine gamma-lyase EC=4.4.1.1 ; Amino-acid biosynthesis Cysteine Cytoplasm Pyridoxal phosphate

 

prodomImg

sp

15

395

S=1080 I=55 E=3.05249e-122

Cystathionine gamma-synthase EC=2.5.1.48 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate Transferase

 

prodomImg

sp

17

393

S=1072 I=56 E=2.8945e-121

Cystathionine gamma-lyase EC=4.4.1.1 ; Amino-acid biosynthesis Cysteine Cytoplasm Phosphoprotein Pyridoxal phosphate

 

prodomImg

sp

16

395

S=1071 I=54 E=3.50652e-121

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

 

prodomImg

Iprscan IPR015421 [G3DSA:3.40.640.10]

8

261

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR015422 [G3DSA:3.90.1150.10]

262

393

Pyridoxal phosphate-dependent transferase, major region, subdomain 2

Iprscan IPR000277 [PIRSF001434]

18

395

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan [PTHR11808:SF15]

95

395

-

Iprscan IPR000277 [PTHR11808]

95

395

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR000277 [PF01053]

18

393

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR000277 [PS00868]

202

216

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

PD596743

192

394

S=193 I=36 E=5.73724e-16

PD585777

214

288

S=183 I=47 E=1.15149e-14

PD590311

279

351

S=146 I=54 E=2.94274e-10

PD494234

90

144

S=143 I=55 E=8.02048e-10

PD831730

192

395

S=138 I=26 E=2.71839e-09

PDA1F7T5

192

222

S=134 I=74 E=8.59271e-09

PD626605

136

193

S=129 I=48 E=3.62162e-08

PD583573

353

395

S=129 I=60 E=3.65334e-08

PD090161

52

94

S=119 I=64 E=6.21304e-07

PDA7H0Y8

145

191

S=117 I=64 E=1.0302e-06

Iprscan IPR015424 [SSF53383]

6

393

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wIYpWdL6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

127 hits
swiss-prot

Swiss-Prot ncbi-blastp

52 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdaGYw9/XFF4834R_chr34960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdaGYw9/XFF4834R_chr34960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdaGYw9/XFF4834R_chr34960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdaGYw9/XFF4834R_chr34960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.