Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34940wzmXFF4834R_chr34940probable O-antigen ABC transporter permease

wzm XFF4834R_chr34940
XFF4834R_chr34930
XFF4834R_chr34930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34950
XFF4834R_chr34950
ID wzm
AC XFF4834R_chr34940
LT XFF4834R_chr34940
OR XFF4834R_chr from 4054297 to 4055091 on strand -
DE probable O-antigen ABC transporter permease
IP ABC-2
CL 4.3.A.1.m membrane component
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: ATP binding (GO:0005524)
coupled to transmembrane movement of substances (GO:0042626)

Curated
PM
AN
CC COG: [GM] Carbohydrate transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 29947.1 Da
SQ 264 aa
 
........10........20........30........40........50
| | | | |
MKDLLRPLWVYRYFIFSSIKNELRMRFIQSKLGALWMIIHPLMQVLIFAT
ILSEVLAAKLPGIDNKYAYALYLMSGTLCWSLFNETINKCVSLFVENGNL
MKKMAFPRICLPFIAAGAMLVNNLLLLLAIFIVFAVLGHYPGQQVLWLPF
LMVLTLTFAMSLGLLLGVFNVFMRDIAQVVPVVLQALFWLTPIVYNISIL
PEDVARVFKLNPLFPLVTAYQQVLLYGTTPEWRSLMPLCAATAILGLMSL
VVFRRASQEMVDAL
Show or not Domain decomposition
 
X.species

YP_365453.1 lcl|wzm-XCV3722

1

264

S=1249 I=92 E=2.28385e-144

O-antigen ABC transporter permease

X.species

NP_635992.1 lcl|wzm-XCC0600

3

264

S=940 I=70 E=5.5798e-107

membrane subunit of LPS efflux transporter

X.species

lcl|wzm-XALc_2710

1

264

S=620 I=45 E=3.55404e-68

probable abc transporter permease protein

X.species

NP_643908.1 lcl|wzm-XAC3601

14

264

S=214 I=23 E=5.05061e-19

ABC transporter permease

pubmed

4

264

S=879 I=69 E=6.19402e-98

ABC transporter

Pubmed 11589581

 

prodomImg

pubmed

1

264

S=515 I=38 E=7.42467e-54

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

3

264

S=511 I=42 E=2.13228e-53

Membrane-spanning domain MSD

Pubmed 9244257

 

prodomImg

pubmed

11

264

S=509 I=37 E=4.39668e-53

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

pubmed

4

264

S=505 I=36 E=1.2194e-52

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

sp

1

264

S=261 I=25 E=3.30112e-23

O-antigen export system permease protein rfbA ; Cell inner membrane Polysaccharide transport Sugar Transmembrane

 

prodomImg

sp

20

264

S=215 I=23 E=1.15373e-17

O-antigen export system permease protein rfbA ; Cell inner membrane Polysaccharide transport Sugar Transmembrane

 

prodomImg

sp

20

264

S=212 I=22 E=2.88196e-17

O-antigen export system permease protein rfbA ; Cell inner membrane Polysaccharide transport Sugar Transmembrane

 

prodomImg

sp

22

228

S=142 I=23 E=9.37025e-09

Teichoic acid translocation permease protein tagG ; Cell membrane Transmembrane Transport

 

prodomImg

Iprscan IPR013525 [PF01061]

17

224

ABC-2 type transporter

Iprscan IPR000412 [PS51012]

32

256

ABC-2

Iprscan [seg]

120

137

-

Iprscan [SignalP-NN(euk)]

1

57

-

Iprscan [tmhmm]

32

52

-

Iprscan [tmhmm]

67

84

-

Iprscan [tmhmm]

113

135

-

Iprscan [tmhmm]

150

172

-

Iprscan [tmhmm]

179

201

-

Iprscan [tmhmm]

234

253

-

PD002060

5

112

S=204 I=36 E=3.03736e-17

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gCjElLqA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoQYmZu/XFF4834R_chr34940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoQYmZu/XFF4834R_chr34940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoQYmZu/XFF4834R_chr34940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoQYmZu/XFF4834R_chr34940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.