Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34930wztXFF4834R_chr34930probable O-antigen ABC transporter ATP-binding protein

wzt XFF4834R_chr34930
XFF4834R_chr34920
XFF4834R_chr34920
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34940
XFF4834R_chr34940
ID wzt
AC XFF4834R_chr34930
LT XFF4834R_chr34930
OR XFF4834R_chr from 4053014 to 4054300 on strand -
DE probable O-antigen ABC transporter ATP-binding protein
IP ATPase, AAA+ type, core
CL 4.3.A.1.a ATP binding component
EC
GO InterPro
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: ATPase activity (GO:0016887)

Curated
PM
AN
CC COG: [GM] Carbohydrate transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 46748.7 Da
SQ 428 aa
 
........10........20........30........40........50
| | | | |
MSDVVMRVEGVGKAYRVWNSQWLRAASWFGAPVQAREEHWILRNVSFSIK
TGESVGVVGRNGAGKSTLLKLITGTVQPTEGVIARSGRIAAILELGMGFN
PDLTGRQNAYHSAGLMGYSQQQIDAAMPGIEGFAEVGEYFDAPVRTYSSG
MQVRVAFAVATAFRPDVLIVDEALSVGDAYFQAKCFKRVQEFKEQGTTLI
LVSHAVGDIVKHCERVLFIKDGGVYADGPAREVSNLYLDELFGRKSSSDP
ARADAPIEAIPGESIDDVFHTRPSYNRNEHRWGQGGAKIVDYAVTSSGER
FPTRIDSGAVTKFHMKIVFERDFDNVVPGLLLKTLEGLFLYGTNSFLASD
GRKTLSPRAGDVVTCHFALPLSVNEGHYMVSLGISSGDPLGELVPLDRRY
DAILLDVSRPMQFWGIVDLNAEFSADVP
XFF4834R

XFF4834R_chr39200 lcl|XFF4834R_chr42420275_4517021_r2_XFF4834R-XFF4834R_chr39200

45

235

S=168 I=26 E=8.99742e-14

XFF4834R

XFF4834R_chr00720 lcl|XFF4834R_chr00730386_0086123_r2_XFF4834R-XFF4834R_chr00720

42

255

S=160 I=24 E=9.14805e-13

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr39320 lcl|XFF4834R_chr42540168_4530163_f2_XFF4834R-XFF4834R_chr39320

42

233

S=148 I=26 E=2.96581e-11

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr29670 lcl|XFF4834R_chr32210295_3409170_f1_XFF4834R-XFF4834R_chr29670

34

258

S=145 I=27 E=5.5079e-11

XFF4834R

XFF4834R_chr35650 lcl|metN-XFF4834R_chr35650

42

233

S=144 I=29 E=8.6673e-11

DL-methionine transporter subunit

XFF4834R

XFF4834R_chr35970 lcl|XFF4834R_chr_4164978_4166057_r2_XFF4834R-XFF4834R_chr35970

42

222

S=141 I=26 E=1.83452e-10

XFF4834R

XFF4834R_chr42240 lcl|XFF4834R_chr_4911550_4912344_f1_XFF4834R-XFF4834R_chr42240

36

231

S=140 I=27 E=2.26152e-10

predicted toluene transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr08340 lcl|tauB-XFF4834R_chr08340

44

219

S=136 I=29 E=7.7998e-10

taurine transporter subunit

XFF4834R

XFF4834R_chr16680 lcl|lptB-XFF4834R_chr16680

37

242

S=133 I=23 E=1.99998e-09

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr37200 lcl|ftsE-XFF4834R_chr37200

39

227

S=130 I=28 E=4.23316e-09

predicted transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr14330 lcl|ssuB-XFF4834R_chr14330

41

229

S=129 I=28 E=5.40365e-09

alkanesulfonate transporter subunit

XFF4834R

XFF4834R_chr21770 lcl|ugpC-XFF4834R_chr21770

42

222

S=128 I=25 E=8.21182e-09

glycerol-3-phosphate transporter subunit

XFF4834R

XFF4834R_chr_2608 lcl|potG-XFF4834R_chr_2608

44

233

S=125 I=23 E=1.64953e-08

putrescine transporter subunit: ATP-binding component of ABC superfamily

XFF4834R

XFF4834R_chr30390 lcl|XFF4834R_chr33000899_3492779_f3_XFF4834R-XFF4834R_chr30390

38

88

S=123 I=43 E=2.88202e-08

XFF4834R

XFF4834R_chr08530 lcl|XFF4834R_chr09110803_0990561_r1_XFF4834R-XFF4834R_chr08530

41

219

S=122 I=26 E=3.46109e-08

XFF4834R

XFF4834R_chr40810 lcl|XFF4834R_chr_4723917_4724792_f3_XFF4834R-XFF4834R_chr40810

38

81

S=118 I=50 E=1.06579e-07

XFF4834R

XFF4834R_chr23270 lcl|ccmA-XFF4834R_chr23270

35

152

S=118 I=31 E=1.17307e-07

heme exporter subunit

XFF4834R

XFF4834R_chr24000 lcl|uup-XFF4834R_chr24000

41

83

S=117 I=47 E=1.3724e-07

fused predicted transporter subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr00750 lcl|XFF4834R_chr00750909_0088754_f3_XFF4834R-XFF4834R_chr00750

165

228

S=112 I=34 E=7.06877e-07

XFF4834R

XFF4834R_chr07490 lcl|XFF4834R_chr07900883_0866544_r1_XFF4834R-XFF4834R_chr07490

41

142

S=107 I=33 E=2.25397e-06

fused predicted transporter subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr07490 lcl|XFF4834R_chr07900883_0866544_r1_XFF4834R-XFF4834R_chr07490

38

83

S=106 I=46 E=3.80311e-06

fused predicted transporter subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr08640 lcl|gsiA-XFF4834R_chr08640

147

233

S=107 I=25 E=2.66007e-06

fused predicted peptide transport subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr14630 lcl|XFF4834R_chr15670385_1684301_f3_XFF4834R-XFF4834R_chr14630

36

89

S=106 I=39 E=3.33689e-06

fused predicted transporter subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr14630 lcl|XFF4834R_chr15670385_1684301_f3_XFF4834R-XFF4834R_chr14630

41

81

S=105 I=44 E=4.94008e-06

fused predicted transporter subunits of ABC superfamily: ATP-binding components

XFF4834R

XFF4834R_chr21880 lcl|lolD-XFF4834R_chr21880

23

230

S=104 I=24 E=5.29695e-06

outer membrane-specific lipoprotein transporter subunit

XFF4834R

XFF4834R_chr36500 lcl|XFF4834R_chr39690175_4226897_r2_XFF4834R-XFF4834R_chr36500

41

222

S=98 I=23 E=3.30516e-05

X.species

YP_365452.1 lcl|wzt-XCV3721

1

427

S=2027 I=90 E=0

O-antigen ABC transporter ATP-binding protein

X.species

NP_635993.1 lcl|wzt-XCC0601

5

423

S=1502 I=65 E=8.12925e-175

ATP binding component of ABC-transporter

X.species

lcl|XALc_2709

1

248

S=722 I=54 E=3.16762e-80

probable abc transporter atp-binding protein

X.species

NP_643907.1 lcl|wzt-XAC3600

2

244

S=508 I=40 E=2.26459e-54

ABC transporter ATP-binding protein

X.species

YP_365875.1 lcl|natA-XCV4144

45

233

S=172 I=27 E=1.13797e-13

Na+ extrusion ABC transporter ATP-binding protein

X.species

NP_644353.1 lcl|natA-XAC4054

45

233

S=172 I=27 E=1.24164e-13

sodium ABC transporter ATP-binding protein

X.species

NP_639316.1 lcl|yadG-XCC3976

42

289

S=163 I=24 E=1.48988e-12

ABC transporter ATP-binding protein

X.species

NP_639308.1 lcl|natA-XCC3969

45

233

S=160 I=26 E=3.35193e-12

sodium ABC transporter ATP-binding protein

X.species

NP_640538.1 lcl|yehX-XAC0182

42

255

S=159 I=24 E=5.27465e-12

ABC transporter ATP-binding protein

X.species

lcl|XALc_3166

36

243

S=158 I=29 E=5.95942e-12

probable abc transporter atp binding protein.

pubmed

1

423

S=1513 I=66 E=1.60952e-174

ABC transporter ; ATP-binding Nucleotide-binding

Pubmed 11589581

 

prodomImg

pubmed

8

425

S=1122 I=50 E=3.70084e-127

Wzt ; ATP-binding Nucleotide-binding

Pubmed 19682076

 

prodomImg

pubmed

6

425

S=1120 I=51 E=7.9018e-127

Putative ATP binding component of ABC-transporter ; ATP-binding Nucleotide-binding

Pubmed 7536735,8162191

 

prodomImg

pubmed

6

425

S=1119 I=51 E=1.091e-126

ATP binding component of ABC-transporter ; ATP-binding Nucleotide-binding

Pubmed 9573168

 

prodomImg

pubmed

6

425

S=1116 I=51 E=2.07983e-126

ATP binding component of ABC-transporter ; ATP-binding Nucleotide-binding

Pubmed 9573168

 

prodomImg

sp

1

237

S=528 I=42 E=2.7737e-55

ABC transporter protein AbcA ; ATP-binding Nucleotide-binding

 

prodomImg

sp

38

237

S=485 I=43 E=3.8471e-50

O-antigen export system ATP-binding protein rfbB ; Cell inner membrane Nucleotide-binding Polysaccharide transport Sugar

 

prodomImg

sp

38

237

S=482 I=43 E=1.09525e-49

O-antigen export system ATP-binding protein rfbB ; Cell inner membrane Nucleotide-binding Polysaccharide transport Sugar

 

prodomImg

sp

1

241

S=465 I=40 E=1.17241e-47

O-antigen export system ATP-binding protein rfbB ; Cell inner membrane Nucleotide-binding Polysaccharide transport Sugar

 

prodomImg

sp

3

241

S=429 I=34 E=2.65193e-43

Teichoic acids export ATP-binding protein TagH EC=3.6.3.40 ; Cell membrane Hydrolase Nucleotide-binding Transport

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

33

235

-

Iprscan [PTHR19222:SF2]

6

301

-

Iprscan [PTHR19222]

6

301

-

Iprscan IPR003439 [PF00005]

66

174

ABC transporter-like

Iprscan IPR003593 [SM00382]

51

223

ATPase, AAA+ type, core

Iprscan IPR017871 [PS00211]

147

161

ABC transporter, conserved site

Iprscan IPR003439 [PS50893]

23

246

ABC transporter-like

Iprscan [seg]

153

164

-

Iprscan [seg]

329

342

-

PDA5R0Q3

240

280

S=189 I=88 E=2.14954e-15

PDA5S114

95

245

S=169 I=28 E=5.22208e-13

PD016623

281

424

S=153 I=32 E=5.07877e-11

PDA1F9E6

170

222

S=152 I=49 E=7.26115e-11

PDA1O0H8

5

41

S=141 I=65 E=1.52228e-09

PDA612X8

170

194

S=137 I=100 E=4.33387e-09

PDA0H4W5

41

78

S=131 I=63 E=2.2715e-08

PDA28160

170

196

S=125 I=81 E=1.2221e-07

PD710448

42

83

S=118 I=50 E=9.23798e-07

PDA61326

170

196

S=109 I=70 E=1.07987e-05

Iprscan [SSF52540]

5

235

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rJiy08ab)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

26 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkvVwlL/XFF4834R_chr34930.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkvVwlL/XFF4834R_chr34930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkvVwlL/XFF4834R_chr34930.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkvVwlL/XFF4834R_chr34930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.