Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34920wxcBXFF4834R_chr34920LPS O-antigen biosynthesis tyrosine kinase

wxcB XFF4834R_chr34920
XFF4834R_chr34910
XFF4834R_chr34910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34930
XFF4834R_chr34930
ID wxcB
AC XFF4834R_chr34920
LT XFF4834R_chr34920
OR XFF4834R_chr from 4050808 to 4052955 on strand -
DE LPS O-antigen biosynthesis tyrosine kinase
IP Recombinase, conserved site; Tyrosine protein kinase, active site; Methyltransferase type 11
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Biological Process: DNA recombination (GO:0006310)
Biological Process: metabolic process (GO:0008152)
Biological Process: protein amino acid phosphorylation (GO:0006468)
Molecular Function: recombinase activity (GO:0000150)
Molecular Function: methyltransferase activity (GO:0008168)
Molecular Function: protein tyrosine kinase activity (GO:0004713)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN this gene belongs to the LPS biosynthesis cluster, functional study in Xcc
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 80195.9 Da
SQ 715 aa
 
........10........20........30........40........50
| | | | |
MTHSVSPGNSSIADLVAALPEKYQPIFGHPEISDGSSRGCEDRLEVILDV
VGHLRTALGRPIRVLDLGCAQGYFSLNLAARGAIVHGADFLDRNVAVCRA
LAEEQGFVAATFECARIEDIVGGLEVGRYDLVLGLSVFHHLIHEHGLEPV
VGLIGQIDACIAVGIYELAVREEPLYWGASQPGDPAQLLQRYAFLRVLAH
QGTHLSGIARPLYFASSRYWLLGNDFREFLSWRTESHAHAMNSHAGTRRY
YFADGVILKQMSLVEASRKKINLAEYENEVSFLRDPPPGVVVPALMHNLQ
DSRDVWILREQLPGRLLSEMIQDKTPYSYEEIADSIIAQLVALEATGLYH
NDLRCWNLLVNDNGTATFIDYGAVSTSAVDCVWPDDLLLSLLITLRELVQ
GQIAQPLPVRRPLLDISMLPVRYRVAFYTVFNRPRGEWTFRALREAIGQK
DDEAERAGWVWLLRKQEHALLIYERSIRAAEARSAEVETKLGESLSNAHH
WYLRANEREDAIDKLNSEIDGLKDTIGELHHLQLSGTSNMHDLRRRLETS
GAGFTVVREQLDELRMQLDSSLQNAHHWYLRASTAEQNLHDIQASASWRL
TRPLRGMARLVRWPRASLKRILLALVRRVLKRPALARVLNNWLRMAPSVH
ARIRGAVAADMGIDSVIQPVVEDRPRPGQVVDVTMVAEPVAAAKLSARGH
KIYERMLAIRNGESA
X.species

YP_365451.1 lcl|wxcB-XCV3720

1

715

S=3447 I=92 E=0

putative protein kinase

X.species

NP_635994.1 lcl|wxcB-XCC0602

11

473

S=1242 I=52 E=5.6812e-143

kinase

pubmed

16

473

S=1237 I=51 E=7.86714e-141

Putative kinase

Pubmed 11589581

 

prodomImg

pubmed

9

386

S=849 I=42 E=9.40662e-94

Putative uncharacterized protein ORF708

Pubmed 7536735,8162191

 

prodomImg

sp

62

141

S=120 I=38 E=1.3783e-05

3-demethylubiquinone-9 3-methyltransferase EC=2.1.1.64 ; S-adenosyl-L-methionine biosynthesis

 

prodomImg

Iprscan [coil]

463

484

-

Iprscan [coil]

505

526

-

Iprscan [G3DSA:3.40.50.150]

58

141

-

Iprscan IPR013216 [PF08241]

65

141

Methyltransferase type 11

Iprscan IPR008266 [PS00109]

348

360

Tyrosine-protein kinase, active site

Iprscan IPR006118 [PS00397]

579

587

Recombinase, conserved site

Iprscan [seg]

387

398

-

Iprscan [seg]

474

488

-

PD140035

142

529

S=1063 I=52 E=3.85367e-121

PDA9P130

519

558

S=193 I=93 E=9.70574e-16

PD514349

15

61

S=188 I=74 E=4.66229e-15

PD313528

564

692

S=179 I=35 E=5.03866e-14

PDA8I6Z1

689

715

S=127 I=93 E=1.10844e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Fk2avBWQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZKGzfg/XFF4834R_chr34920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZKGzfg/XFF4834R_chr34920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZKGzfg/XFF4834R_chr34920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZKGzfg/XFF4834R_chr34920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.