Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34890rmdXFF4834R_chr34890putative UDP-glucose 4-epimerase

rmd XFF4834R_chr34890
XFF4834R_chr_4585
XFF4834R_chr_4585
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34900
XFF4834R_chr34900
ID rmd
AC XFF4834R_chr34890
LT XFF4834R_chr34890
OR XFF4834R_chr from 4046206 to 4047162 on strand -
DE putative UDP-glucose 4-epimerase
IP NAD-dependent epimerase/dehydratase
CL 1.6.3 Lipopolysaccharide GO:0009103
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [GM] Carbohydrate transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 34758.5 Da
SQ 318 aa
 
........10........20........30........40........50
| | | | |
MNVAFHSKLAGKRILVTGASGFTGRYVVEELIRSGGQVISLGTSATNVAR
PPIEGESYYQADLRDCASLTKVVEVSEPDIVVHLAALAFVGHGRAEDFYN
INLLGTRNLLQALESRASKIERVLLASSANVYGNLSSGLLDESVAPLPAN
EYAISKLAMEHLARIRMGVLPITIARPFNYTGVGQSSEFLIPKIVSHYAK
RSEYIELGNLDVARDFGDVRAVAQAYRLLLEAPQAESLTVNVCTGRGHSL
RDILELCEGLSEWSLDVRVNPAFVRANEVKVLLGDNSLLLRLVKQWDCPP
IEDTLRWMLKAELSAIQA
XFF4834R

XFF4834R_chr36310 lcl|galE-XFF4834R_chr36310

13

307

S=189 I=30 E=2.34327e-16

UDP-galactose-4-epimerase

XFF4834R

XFF4834R_chr34900 lcl|gmd-XFF4834R_chr34900

9

314

S=181 I=25 E=1.69574e-15

GDP-D-mannose dehydratase, NAD(P)-binding

XFF4834R

XFF4834R_chr34790 lcl|rffG-XFF4834R_chr34790

16

196

S=122 I=28 E=2.99729e-08

dTDP-glucose 4,6-dehydratase

XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

14

160

S=116 I=30 E=1.39045e-07

XFF4834R

XFF4834R_chr26060 lcl|XFF4834R_chr28550256_3012215_r2_XFF4834R-XFF4834R_chr26060

13

196

S=104 I=29 E=4.66784e-06

predicted NAD(P)H-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain

X.species

NP_636000.1 lcl|rmd-XCC0608

3

311

S=927 I=57 E=2.89802e-105

UDP-glucose 4-epimerase

X.species

YP_365448.1 lcl|rmd-XCV3717

3

311

S=905 I=56 E=1.21941e-102

NDP-hexose oxidoreductase

X.species

lcl|rmd-XALc_2707

12

289

S=327 I=34 E=1.28821e-32

probable ndp-hexose oxidoreductase protein

X.species

YP_365590.1 lcl|galE-XCV3859

13

307

S=185 I=29 E=2.61879e-15

UDP-glucose 4-epimerase

X.species

NP_644047.1 lcl|XAC3740-XAC3740

13

307

S=184 I=29 E=3.4017e-15

UDP-glucose 4-epimerase

X.species

NP_639042.1 lcl|XCC3696

13

307

S=183 I=29 E=4.61555e-15

UDP-glucose 4-epimerase

X.species

NP_640410.1 lcl|rmd-XAC0054

13

285

S=180 I=28 E=8.57167e-15

degenerated UDP-glucose epimerase

X.species

YP_365449.1 lcl|gmd-XCV3718

9

314

S=174 I=25 E=5.39533e-14

GDP-mannose 4,6-dehydratase

X.species

lcl|gmd-XALc_2706

12

285

S=170 I=27 E=1.76597e-13

probable gdp-mannose 4,6-dehydratase protein

X.species

NP_635998.1 lcl|XCC0606

12

292

S=160 I=26 E=2.56708e-12

GDP-mannose 4,6 dehydratase

X.species

YP_365440.1 lcl|rmlB-XCV3709

15

230

S=145 I=29 E=1.82407e-10

dTDP-glucose 4,6-dehydratase

X.species

NP_643892.1 lcl|rmlB-XAC3585

15

260

S=145 I=28 E=1.85615e-10

dTDP-glucose 4,6-dehydratase

X.species

NP_636013.1 lcl|rmlB-XCC0621

15

260

S=144 I=28 E=2.41106e-10

dTDP-glucose 4,6-dehydratase

X.species

lcl|rmlB-XALc_2697

15

196

S=141 I=31 E=4.67717e-10

probable dtdp-glucose 4,6-dehydratase protein

X.species

lcl|gla-XALc_0106

14

160

S=125 I=30 E=4.58865e-08

putative nucleoside-diphosphate-sugar epimerases protein

X.species

NP_644209.1 lcl|wbnF-XAC3908

14

160

S=120 I=31 E=1.65311e-07

nucleotide sugar epimerase

X.species

YP_364499.1 lcl|cdh2-XCV2768

13

196

S=114 I=30 E=8.89399e-07

NAD(P)H steroid dehydrogenase

X.species

YP_365752.1 lcl|wbnF-XCV4021

14

160

S=114 I=30 E=8.97187e-07

nucleotide sugar epimerase

X.species

NP_639193.1 lcl|wbnF-XCC3853

14

160

S=111 I=30 E=1.89899e-06

nucleotide sugar epimerase

X.species

lcl|XALc_3068

13

226

S=111 I=28 E=2.32066e-06

putative nad(p)h steroid dehydrogenase protein

X.species

YP_363903.1 lcl|XCV2172

7

63

S=99 I=42 E=6.60131e-05

short chain dehydrogenase

X.species

NP_635614.1 lcl|cdh-XCC0219

13

131

S=98 I=29 E=7.58952e-05

NAD(P)H steroid dehydrogenase

X.species

NP_642883.1 lcl|cdh-XAC2569

13

196

S=98 I=29 E=8.13778e-05

NAD(P)H steroid dehydrogenase

pubmed

3

310

S=924 I=57 E=2.43946e-103

Putative NDP-hexose epimerase/oxydoreductase EC=1.1.1.187 ; Oxidoreductase

Pubmed 11589581

 

prodomImg

pubmed

10

312

S=910 I=57 E=1.33444e-101

Rmd

Pubmed 19682076

 

prodomImg

pubmed

13

311

S=308 I=31 E=1.21249e-28

GDP-6-deoxy-D-lyxo-4-hexulose reductase

Pubmed 11096116,15044388

 

prodomImg

pubmed

12

289

S=302 I=33 E=6.19091e-28

Oxidoreductase Rmd

Pubmed 9781879

 

prodomImg

pubmed

12

260

S=232 I=29 E=1.81293e-19

Putative uncharacterized protein

Pubmed 18957592

 

prodomImg

sp

9

255

S=222 I=30 E=2.17388e-18

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

 

prodomImg

sp

14

271

S=205 I=27 E=2.62913e-16

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

 

prodomImg

sp

15

316

S=199 I=26 E=1.52998e-15

GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

sp

13

253

S=196 I=32 E=2.79226e-15

Probable dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase NAD Plasmid

 

prodomImg

sp

12

195

S=188 I=33 E=2.7417e-14

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

12

263

NAD(P)-binding domain

Iprscan [PTHR10366]

16

311

-

Iprscan IPR001509 [PF01370]

14

242

NAD-dependent epimerase/dehydratase

PD685311

177

256

S=168 I=47 E=6.9918e-13

PD750795

132

176

S=141 I=58 E=1.50215e-09

PDA8G4K0

148

292

S=134 I=26 E=8.44193e-09

PDA00487

11

146

S=123 I=32 E=2.10699e-07

PD894442

8

67

S=119 I=46 E=6.05103e-07

PDA1F4T8

265

301

S=119 I=62 E=6.15747e-07

PDA8Q6I7

7

184

S=110 I=31 E=8.0616e-06

PDA7R3C7

260

311

S=108 I=46 E=1.45849e-05

Iprscan IPR016040 [SSF51735]

13

313

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one V2QoKF7Q)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

111 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBobUPX2/XFF4834R_chr34890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBobUPX2/XFF4834R_chr34890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBobUPX2/XFF4834R_chr34890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBobUPX2/XFF4834R_chr34890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.