Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34850XFF4834R_chr37980920_4041248_f3_XFF4834R-XFF4834R_chr34850XFF4834R_chr34850putative protoporphyrinogen oxidase

XFF4834R_chr37980920_4041248_f3_XFF4834R-XFF4834R_chr34850 XFF4834R_chr34850
XFF4834R_chr34840
XFF4834R_chr34840
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34860
XFF4834R_chr34860
ID XFF4834R_chr37980920_4041248_f3_XFF4834R-XFF4834R_chr34850
AC XFF4834R_chr34850
LT XFF4834R_chr34850
OR XFF4834R_chr from 4039920 to 4041248 on strand +
DE putative protoporphyrinogen oxidase
IP Amine oxidase
CL 1.5.3.12 Heme, porphyrin GO:0006783 GO:0006779
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN this gene is in the LPS biosynthesis cluster and has othologs in X. albilineans and in Pseudomonas syringae pv phaseolicola
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110224)
MW 49519.2 Da
SQ 442 aa
 
........10........20........30........40........50
| | | | |
MTTPQSIYHTAVVGGGFSGLATAYALARAGKRVILVEQDHELGGLAGGFT
VGSEVLEKFYHHWFNNDKEIFQLIDELGARDNVLLRPTRTGMYYAQQFFR
LSTPMDLLRFKALPFIDRIRLGISVLRARQVKDWRQLENLTAKEWLISLC
GQKVYDVVWDPLLVGKFGAVADDVSAVWFWKKLVLRGGSRSSSGDEVLAY
YRGGFAALAEKMGEAIRALGGEILMGTAAVSVTSANGRATGVALQDRQIT
AENVVLSTAFPITADLLEGQVPADYLQKLRRVRYLANVCMVLSLDRSLSD
TYWLNVNDPGFPYVGVIEHTNFEPPSSYGGRHIVYLSKYLPTTHSMYTMN
DQELVDFSIPHLQKMFPSFERSWIQDVHVWRAEYAQPIAEKHYSTFVPGR
TTPLPNVFVTSMAQVYPEDRGTNYAVREGRQLAQQILEAGTQ
X.species

lcl|XALc_2703

8

437

S=1873 I=79 E=0

probable protoporphyrinogen oxidase protein

X.species

NP_643901.1 lcl|XAC3594-XAC3594

11

436

S=616 I=29 E=2.08923e-67

hypothetical protein

pubmed

11

434

S=597 I=29 E=1.60438e-63

Putative phytoene desaturase

Pubmed 15473911

 

prodomImg

pubmed

12

262

S=173 I=28 E=3.94234e-12

Putative uncharacterized protein

Pubmed 14583260

 

prodomImg

pubmed

8

393

S=167 I=20 E=2.31428e-11

BarJ

Pubmed 12383521

 

prodomImg

pubmed

1

175

S=129 I=26 E=8.60452e-07

Protoporphyrinogen oxidase, chloroplastic/mitochondrial EC=1.3.3.4 ; Alternative initiation Chlorophyll biosynthesis FAD Flavoprotein Heme Membrane Mit

Pubmed 11274159

 

prodomImg

pubmed

4

175

S=122 I=27 E=5.96116e-06

Mitochondrial protoporphyrinogen oxidase long form

Pubmed 16894159

 

prodomImg

pubmed

4

168

S=121 I=27 E=7.28484e-06

Mitochondrial protoporphyrinogen oxidase long form

Pubmed 16894159

 

prodomImg

pubmed

4

175

S=120 I=27 E=9.46271e-06

Mitochondrial protoporphyrinogen oxidase

Pubmed 16894159

 

prodomImg

pubmed

4

168

S=120 I=27 E=1.03248e-05

Mitochondrial protoporphyrinogen oxidase

Pubmed 16894159

 

prodomImg

pubmed

4

175

S=120 I=27 E=1.15639e-05

Mitochondrial protoporphyrinogen oxidase

Pubmed 16894159

 

prodomImg

pubmed

4

169

S=119 I=27 E=1.25079e-05

Mitochondrial protoporphyrinogen oxidase

Pubmed 16894159

 

prodomImg

sp

1

175

S=129 I=26 E=5.92344e-07

Protoporphyrinogen oxidase, chloroplastic/mitochondrial EC=1.3.3.4 ; Alternative initiation Chlorophyll biosynthesis FAD Flavoprotein Heme Membrane Mit

 

prodomImg

Iprscan [G3DSA:3.50.50.60]

8

438

-

Iprscan IPR002937 [PF01593]

17

437

Amine oxidase

Iprscan [seg]

186

194

-

Iprscan [tmhmm]

7

26

-

PD573282

261

436

S=425 I=44 E=6.03103e-44

PD136540

56

208

S=305 I=40 E=1.69705e-29

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hchL38e0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsBJSPQ/XFF4834R_chr34850.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsBJSPQ/XFF4834R_chr34850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsBJSPQ/XFF4834R_chr34850.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsBJSPQ/XFF4834R_chr34850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.