Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34810etfAXFF4834R_chr34810probable electron transfer flavoprotein alpha subunit

etfA XFF4834R_chr34810
XFF4834R_chr34800
XFF4834R_chr34800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3700
XFF4834R_chr_3700
ID etfA
AC XFF4834R_chr34810
LT XFF4834R_chr34810
OR XFF4834R_chr from 4036724 to 4037668 on strand +
DE probable electron transfer flavoprotein alpha subunit
IP Electron transfer flavoprotein, beta-subunit, conserved site; Electron transfer flavoprotein, alpha subunit; Electron transfer flavoprotein, alpha subunit, C-terminal; Electron transfer flavoprotein, alpha subunit, C-terminal, conserved site
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: FAD binding (GO:0050660)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110224)
MW 31926.1 Da
SQ 314 aa
 
........10........20........30........40........50
| | | | |
MAKVLVVAEHLNGQLNAATAKTLSAALAISAESIDVVVLAADPAAVAAQA
AQLAGVARVLTVANPANEHAIAQVLGPQIAQLAGQGYTHVFGPSTTFGKD
LMPVVAALLGVNQISDLMSVEDAYTFKRPIYAGNAIITVRAPADQSVVAT
VRSASWPEAAGGGSATVESATVEVALPTHTRFVGLAAGSSDRPDLQSAKR
VVSGGRGVGSAENFQHIYSLADKLGAAVGASRAAVDAGYVPNELQVGQTG
KIIAPELYVAIGISGAIQHLTGIKDAGTIVAINKDPESPIFEIADIGLVG
DLFELLPQLEMKLG
X.species

YP_365442.1 lcl|etfA-XCV3711

1

313

S=1173 I=76 E=4.44084e-135

electron transfer flavoprotein alpha subunit

X.species

NP_643894.1 lcl|etfA-XAC3587

1

314

S=1160 I=74 E=1.714e-133

electron transfer flavoprotein alpha subunit

X.species

NP_636011.1 lcl|etfA-XCC0619

1

313

S=1157 I=74 E=3.75661e-133

electron transfer flavoprotein alpha subunit

X.species

lcl|etfA-XALc_2699

1

314

S=1045 I=68 E=1.53915e-119

probable electron transfer flavoprotein alpha subunit

pubmed

1

313

S=1151 I=73 E=8.72345e-131

Putative electron-transferring flavoprotein alpha subunit

Pubmed 11589581

 

prodomImg

pubmed

1

313

S=943 I=64 E=1.22143e-105

Electron transfer flavoprotein alpha subunit

Pubmed 16585771

 

prodomImg

pubmed

58

313

S=559 I=49 E=4.46191e-59

Electron transfer flavoprotein subunit A

Pubmed 11160087

 

prodomImg

pubmed

58

313

S=543 I=48 E=3.52014e-57

Electron transfer flavoprotein subunit alpha ; transport FAD

Pubmed 8376381,1576992

 

prodomImg

pubmed

69

314

S=525 I=48 E=5.38732e-55

Electron transfer flavoprotein subunit alpha ; transport FAD

Pubmed 8599534

 

prodomImg

pubmed

87

309

S=511 I=49 E=2.74844e-53

Electron transfer flavoprotein alpha subunit

Pubmed 17526788,17618403

 

prodomImg

pubmed

69

309

S=509 I=45 E=4.32499e-53

Probable electron transfer flavoprotein subunit alpha, mitochondrial ; transport FAD Mitochondrion Transit peptide

Pubmed 15538538

 

prodomImg

pubmed

87

309

S=509 I=47 E=5.14891e-53

Electron-transfer-flavoprotein, alpha polypeptide Electron-transfer-flavoprotein, alpha polypeptide (Glutaric aciduria II) cDNA FLJ76486, highl

Pubmed 12815589

 

prodomImg

pubmed

87

309

S=509 I=47 E=5.14891e-53

Electron transfer flavoprotein subunit alpha, mitochondrial ; Disease mutation transport FAD Glutaricaciduria Mitochondrion Phosphoprotein Pol

Pubmed 3170610

 

prodomImg

pubmed

58

314

S=508 I=42 E=6.23761e-53

ETF1p

Pubmed 15538538

 

prodomImg

sp

58

310

S=580 I=49 E=9.23977e-62

Electron transfer flavoprotein subunit alpha ; transport FAD

 

prodomImg

sp

58

309

S=578 I=47 E=1.45398e-61

Electron transfer flavoprotein subunit alpha, mitochondrial ; transport FAD Mitochondrion Transit peptide

 

prodomImg

sp

58

313

S=543 I=48 E=2.42389e-57

Electron transfer flavoprotein subunit alpha ; transport FAD

 

prodomImg

sp

69

314

S=525 I=48 E=3.70959e-55

Electron transfer flavoprotein subunit alpha ; transport FAD

 

prodomImg

sp

59

313

S=523 I=43 E=6.53806e-55

Electron transfer flavoprotein subunit alpha, mitochondrial ; transport FAD Mitochondrion Transit peptide

 

prodomImg

PD002994

212

313

S=320 I=59 E=2.53818e-31

PD308383

58

156

S=192 I=44 E=7.65163e-16

PDA1K1H1

157

197

S=177 I=83 E=5.58103e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CGgrb5WI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

60 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBz3EgK5/XFF4834R_chr34810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBz3EgK5/XFF4834R_chr34810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBz3EgK5/XFF4834R_chr34810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBz3EgK5/XFF4834R_chr34810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.