Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34800etfBXFF4834R_chr34800electron transfer flavoprotein beta subunit

etfB XFF4834R_chr34800
XFF4834R_chr_3697
XFF4834R_chr_3697
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34810
XFF4834R_chr34810
ID etfB
AC XFF4834R_chr34800
LT XFF4834R_chr34800
OR XFF4834R_chr from 4035978 to 4036724 on strand +
DE electron transfer flavoprotein beta subunit
IP Electron transfer flavoprotein, beta-subunit, conserved site
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: acur
CC STATUS: curated by opruvost (20100503)
MW 26427.4 Da
SQ 248 aa
 
........10........20........30........40........50
| | | | |
MKILVAYKRVVDYNVRIQVKPDGSGVLTEGVKLSPNPFDEIALEEALRLR
DAGIATEVVVATLAPADAAAHLRNGLAMGANRAIHVVTDAAIQPLTAART
LLKLVEKEQPDLVILGKQAIDDDANQTGQMLATLWGRPQATFAGKLAVAG
GKATVTREVDAGLETLEVDLPAVVTTDLRLNEPRFIKLPDIMKAKSKPLE
TLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVAALKQKGLM
X.species

YP_365441.1 lcl|etfB-XCV3710

1

248

S=1172 I=92 E=3.92244e-135

electron transfer flavoprotein subunit beta

X.species

NP_643893.1 lcl|etfB-XAC3586

1

248

S=1168 I=92 E=1.20786e-134

electron transfer flavoprotein beta subunit

X.species

NP_636012.1 lcl|etfB-XCC0620

1

248

S=1161 I=91 E=1.02261e-133

electron transfer flavoprotein beta subunit

X.species

lcl|etfB-XALc_2698

1

248

S=1108 I=87 E=2.43323e-127

probable electron transfer flavoprotein beta subunit

pubmed

1

248

S=1161 I=91 E=3.75571e-132

Electron transfer flavoprotein beta subunit Putative electron-transferring flavoprotein beta subunit

Pubmed 11589581

 

prodomImg

pubmed

1

248

S=1112 I=88 E=3.0847e-126

Electron transfer flavoprotein beta subunit

Pubmed 16585771

 

prodomImg

pubmed

1

245

S=675 I=56 E=2.97699e-73

Electron transfer flavoprotein subunit beta ; transport FAD

Pubmed 8599534

 

prodomImg

pubmed

1

243

S=639 I=55 E=5.51021e-69

Electron transfer flavoprotein B subunit

Pubmed 11160087

 

prodomImg

pubmed

1

246

S=610 I=52 E=1.79906e-65

Electron transfer flavoprotein subunit beta ; Acetylation Alternative splicing Disease mutation transport FAD Glutaricaciduria Mitochondrion

Pubmed 8504797,12815589

 

prodomImg

pubmed

1

248

S=598 I=51 E=5.29918e-64

Electron transfer flavoprotein subunit beta ; transport FAD

Pubmed 8376381,1576992

 

prodomImg

pubmed

1

244

S=462 I=42 E=1.56858e-47

Probable electron transfer flavoprotein subunit beta ; transport FAD Mitochondrion

Pubmed 8904340

 

prodomImg

pubmed

4

168

S=402 I=48 E=3.32961e-40

Putative electron transfer flavoprotein beta subunit

Pubmed 16339940

 

prodomImg

pubmed

1

213

S=275 I=33 E=7.02067e-25

Electron transfer flavoprotein subunit beta ; transport FAD

Pubmed 7798207,12567183

 

prodomImg

pubmed

1

202

S=250 I=35 E=7.25165e-22

Electron transfer flavoprotein subunit beta ; transport FAD

Pubmed 9694853

 

prodomImg

sp

1

246

S=679 I=56 E=5.60154e-74

Electron transfer flavoprotein subunit beta, mitochondrial ; Alternative splicing transport FAD Mitochondrion Transit peptide

 

prodomImg

sp

1

245

S=675 I=56 E=2.05351e-73

Electron transfer flavoprotein subunit beta ; transport FAD

 

prodomImg

sp

1

246

S=658 I=54 E=1.8626e-71

Electron transfer flavoprotein subunit beta ; transport FAD

 

prodomImg

sp

1

246

S=626 I=53 E=1.79276e-67

Electron transfer flavoprotein subunit beta, mitochondrial ; transport FAD Mitochondrion Transit peptide

 

prodomImg

sp

1

246

S=624 I=53 E=2.56313e-67

Electron transfer flavoprotein subunit beta, mitochondrial ; transport FAD Mitochondrion Transit peptide

 

prodomImg

PD003528

115

209

S=307 I=65 E=9.42911e-30

PDA1L330

211

248

S=174 I=89 E=1.3072e-13

PD239425

1

40

S=142 I=68 E=8.72392e-10

PDA9A9O8

1

247

S=128 I=30 E=5.25254e-08

PD974082

41

115

S=110 I=42 E=7.62893e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Un05t0q2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

56 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHzs3ZF/XFF4834R_chr34800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHzs3ZF/XFF4834R_chr34800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHzs3ZF/XFF4834R_chr34800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHzs3ZF/XFF4834R_chr34800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.