Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34790rmlBXFF4834R_chr34790dTDP-glucose 4,6-dehydratase

rmlB XFF4834R_chr34790
XFF4834R_chr34780
XFF4834R_chr34780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3697
XFF4834R_chr_3697
ID rmlB
AC XFF4834R_chr34790
LT XFF4834R_chr34790
OR XFF4834R_chr from 4034703 to 4035758 on strand -
DE dTDP-glucose 4,6-dehydratase
IP NAD-dependent epimerase/dehydratase
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
6-dehydratase activity (GO:0008460)
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Biological Process: nucleotide-sugar metabolic process (GO:0009225)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN start change : alternative codon Val located 6 aa before the initial start which is also a Val (but it is coded as a M on the initial sequence and multialign) syn rfbB (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 38477 Da
SQ 351 aa
 
........10........20........30........40........50
| | | | |
VATWLVTGGAGFIGGNFVLEAVARGVRVINLDALTYAGNLKTLASLEDNP
NHVFVKGNIGDGALVDRLLAEHQPDAVLNFAAESHVDRSIDGPGAFIQTN
VVGTLALLESVRDYWKALPQESRHAFRFLHVSTDEVYGTLGETGKFTETT
PYAPNSPYSASKAASDHLVRAFHHTYGLPVLTTNCSNNYGPYHFPEKLIP
LVIAKALAGEPLPVYGDGKQVRDWLFVSDHCDAIRTVLAKGRVGETYNVG
GNAERQNIEVVRTICALLDQQRPRSDGQLRASQITHVTDRPGHDRRYAID
ASKLRNELGWQPAYTFEQGIALTVQWYLDNQAWVQGVLDGSYRLERIGVA
A
XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

3

326

S=232 I=29 E=1.25965e-21

XFF4834R

XFF4834R_chr34900 lcl|gmd-XFF4834R_chr34900

5

325

S=162 I=24 E=4.42989e-13

GDP-D-mannose dehydratase, NAD(P)-binding

XFF4834R

XFF4834R_chr36310 lcl|galE-XFF4834R_chr36310

5

250

S=142 I=30 E=1.07619e-10

UDP-galactose-4-epimerase

X.species

YP_365440.1 lcl|rmlB-XCV3709

1

351

S=1709 I=91 E=0

dTDP-glucose 4,6-dehydratase

X.species

NP_643892.1 lcl|rmlB-XAC3585

1

351

S=1696 I=90 E=0

dTDP-glucose 4,6-dehydratase

X.species

NP_636013.1 lcl|rmlB-XCC0621

1

348

S=1676 I=89 E=0

dTDP-glucose 4,6-dehydratase

X.species

lcl|rmlB-XALc_2697

1

351

S=1657 I=88 E=0

probable dtdp-glucose 4,6-dehydratase protein

X.species

lcl|rmd-XALc_2707

5

331

S=248 I=29 E=5.38248e-23

probable ndp-hexose oxidoreductase protein

X.species

YP_365752.1 lcl|wbnF-XCV4021

3

326

S=242 I=28 E=3.66449e-22

nucleotide sugar epimerase

X.species

NP_639193.1 lcl|wbnF-XCC3853

3

326

S=235 I=29 E=2.45172e-21

nucleotide sugar epimerase

X.species

NP_644209.1 lcl|wbnF-XAC3908

3

326

S=233 I=29 E=4.39711e-21

nucleotide sugar epimerase

X.species

lcl|gla-XALc_0106

3

329

S=229 I=26 E=1.38991e-20

putative nucleoside-diphosphate-sugar epimerases protein

X.species

lcl|gmd-XALc_2706

5

324

S=169 I=24 E=2.4354e-13

probable gdp-mannose 4,6-dehydratase protein

X.species

YP_365449.1 lcl|gmd-XCV3718

5

325

S=149 I=24 E=6.34396e-11

GDP-mannose 4,6-dehydratase

X.species

NP_644047.1 lcl|XAC3740-XAC3740

5

250

S=143 I=30 E=2.94297e-10

UDP-glucose 4-epimerase

X.species

NP_635998.1 lcl|XCC0606

1

238

S=142 I=25 E=3.78961e-10

GDP-mannose 4,6 dehydratase

X.species

YP_365590.1 lcl|galE-XCV3859

5

250

S=141 I=30 E=6.45016e-10

UDP-glucose 4-epimerase

X.species

NP_639042.1 lcl|XCC3696

5

338

S=133 I=27 E=5.4135e-09

UDP-glucose 4-epimerase

pubmed

1

348

S=1689 I=90 E=0

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

Pubmed 8253667

 

prodomImg

pubmed

1

351

S=1647 I=87 E=0

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase NAD

Pubmed 16585771

 

prodomImg

pubmed

5

343

S=1238 I=68 E=2.86857e-141

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase NAD

Pubmed 9988483

 

prodomImg

pubmed

5

351

S=1151 I=61 E=9.31114e-131

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase NAD

Pubmed 12949172

 

prodomImg

pubmed

5

348

S=1138 I=62 E=3.59376e-129

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase NAD

Pubmed 19451248

 

prodomImg

sp

1

348

S=1689 I=90 E=0

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

sp

1

348

S=1676 I=89 E=0

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

sp

5

348

S=1138 I=62 E=2.76446e-129

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

sp

5

349

S=1079 I=60 E=3.35862e-122

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

sp

5

343

S=1076 I=58 E=9.23412e-122

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lipopolysaccharide biosynthesis Lyase NAD

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

270

NAD(P)-binding domain

Iprscan [PTHR10366:SF41]

6

343

-

Iprscan [PTHR10366]

6

343

-

Iprscan IPR001509 [PF01370]

4

250

NAD-dependent epimerase/dehydratase

Iprscan IPR005888 [TIGR01181]

3

337

dTDP-glucose 4,6-dehydratase

PD322104

233

290

S=170 I=61 E=4.08844e-13

PDA0L2W2

75

315

S=169 I=28 E=5.31071e-13

PD834433

64

101

S=167 I=79 E=9.11835e-13

PD949051

148

274

S=147 I=26 E=2.15802e-10

PD351626

102

143

S=139 I=62 E=2.1751e-09

PD579696

291

337

S=137 I=59 E=3.70216e-09

PD594924

180

229

S=135 I=55 E=6.81571e-09

PD345228

142

185

S=132 I=61 E=1.79396e-08

PD955726

36

112

S=127 I=39 E=6.08028e-08

PDA1R5W0

289

333

S=123 I=45 E=1.85608e-07

Iprscan IPR016040 [SSF51735]

3

342

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RBAZwefh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

126 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf7SUKx/XFF4834R_chr34790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf7SUKx/XFF4834R_chr34790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf7SUKx/XFF4834R_chr34790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf7SUKx/XFF4834R_chr34790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.