Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34780rmlAXFF4834R_chr34780glucose-1-phosphate thymidylyltransferase

rmlA XFF4834R_chr34780
XFF4834R_chr34770
XFF4834R_chr34770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34790
XFF4834R_chr34790
ID rmlA
AC XFF4834R_chr34780
LT XFF4834R_chr34780
OR XFF4834R_chr from 4033764 to 4034651 on strand -
DE glucose-1-phosphate thymidylyltransferase
IP Glucose-1-phosphate thymidylyltransferase, long form
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Biological Process: extracellular polysaccharide biosynthetic process (GO:0045226)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: glucose-1-phosphate thymidylyltransferase activity (GO:0008879)
Molecular Function: nucleotidyltransferase activity (GO:0016779)

Curated
PM
AN syn rfbA (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 32971.3 Da
SQ 295 aa
 
........10........20........30........40........50
| | | | |
MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIR
EVLIINTPHEQSLFQTLLGDGEQWGMHIRYAVQPSPDGLAQAYLIGRDFI
DGKPSCLVLGDNIFHGHGLTDTLRRADARQQGATVFGYWVNDPERYGVAE
FDAQGKVIDIEEKPLQPRSNYAVTGLYFYDARACEYAAQLKPSSRGELEI
TDLNRRYLEAGDLHLEPLGRGYAWLDTGTHQSLHEASNFIETIQMRQGLQ
VCCPEEIAFAKGWIDAFQLEQLAAPLRKNAYGQYLHSLAQRGVVP
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr22950 lcl|galU-XFF4834R_chr22950

4

237

S=141 I=26 E=1.34408e-10

glucose-1-phosphate uridylyltransferase

XFF4834R

XFF4834R_chr16850 lcl|XFF4834R_chr18040300_1936010_r2_XFF4834R-XFF4834R_chr16850

5

111

S=115 I=31 E=1.91684e-07

X.species

lcl|rmlA-XALc_2696

1

295

S=1418 I=89 E=8.78514e-165

probable glucose-1-phosphate thymidylyltransferase protein

X.species

NP_643891.1 lcl|rmlA-XAC3584

1

295

S=1411 I=88 E=6.75758e-164

glucose-1-phosphate thymidylyltransferase

X.species

YP_365439.1 lcl|rmlA-XCV3708

1

294

S=1403 I=88 E=5.77127e-163

glucose-1-phosphate thymidylyltransferase

X.species

NP_636014.1 lcl|rmlA-XCC0622

1

294

S=1389 I=88 E=2.79426e-161

glucose-1-phosphate thymidylyltransferase

X.species

NP_637544.1 lcl|galU-XCC2188

4

237

S=156 I=27 E=6.9634e-12

UTP-glucose-1-phosphate uridylyltransferase

X.species

NP_642609.1 lcl|galU-XAC2292

4

237

S=144 I=26 E=2.21852e-10

UTP-glucose-1-phosphate uridylyltransferase

X.species

YP_364221.1 lcl|galU-XCV2490

4

237

S=142 I=26 E=3.25589e-10

UTP-glucose-1-phosphate uridylyltransferase

X.species

lcl|XALc_2122

5

111

S=132 I=37 E=5.83449e-09

putative nucleotidyl transferase protein

X.species

lcl|galU-XALc_1596

4

237

S=129 I=26 E=1.33574e-08

probable utp-glucose-1-phosphate uridylyltransferase protein

X.species

NP_638133.1 lcl|glgC-XCC2785

5

111

S=126 I=34 E=3.39529e-08

nucleotidyl transferase

X.species

YP_364831.1 lcl|XCV3100

5

111

S=120 I=32 E=1.4948e-07

putative nucleotidyltransferase

X.species

NP_643264.1 lcl|XAC2955-XAC2955

5

111

S=120 I=32 E=1.56141e-07

nucleotidyl transferase

pubmed

1

294

S=1389 I=88 E=1.14153e-159

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

Pubmed 8253667

 

prodomImg

pubmed

1

294

S=1357 I=86 E=9.39144e-156

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 16585771

 

prodomImg

pubmed

4

288

S=1077 I=70 E=8.36635e-122

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 9988483

 

prodomImg

pubmed

5

295

S=1071 I=67 E=3.91514e-121

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 15073305

 

prodomImg

pubmed

1

290

S=1068 I=68 E=8.00278e-121

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 19040662

 

prodomImg

sp

1

294

S=1389 I=88 E=7.77261e-160

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

 

prodomImg

sp

1

294

S=1389 I=88 E=7.77261e-160

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

 

prodomImg

sp

1

290

S=1065 I=68 E=1.39722e-120

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

 

prodomImg

sp

1

290

S=1063 I=68 E=2.33705e-120

Glucose-1-phosphate thymidylyltransferase 1 EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

 

prodomImg

sp

1

290

S=1057 I=68 E=1.20373e-119

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

 

prodomImg

Iprscan [G3DSA:3.90.550.10]

5

294

-

Iprscan [PTHR22572:SF13]

12

289

-

Iprscan [PTHR22572]

12

289

-

Iprscan IPR005835 [PF00483]

5

241

Nucleotidyl transferase

Iprscan IPR005907 [TIGR01207]

5

290

Glucose-1-phosphate thymidylyltransferase, long form

PD001252

7

293

S=475 I=40 E=4.64042e-50

PDA95123

5

80

S=120 I=38 E=5.56705e-07

PDA036R5

1

114

S=102 I=25 E=6.67446e-05

Iprscan [SSF53448]

4

294

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one I0eta0Wc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

293 hits
swiss-prot

Swiss-Prot ncbi-blastp

165 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBsbgPD/XFF4834R_chr34780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBsbgPD/XFF4834R_chr34780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBsbgPD/XFF4834R_chr34780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBBsbgPD/XFF4834R_chr34780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.