Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34770rmlCXFF4834R_chr34770dTDP-4-dehydrorhamnose 3,5-epimerase

rmlC XFF4834R_chr34770
XFF4834R_chr34760
XFF4834R_chr34760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34780
XFF4834R_chr34780
ID rmlC
AC XFF4834R_chr34770
LT XFF4834R_chr34770
OR XFF4834R_chr from 4033210 to 4033767 on strand -
DE dTDP-4-dehydrorhamnose 3,5-epimerase
IP dTDP-4-dehydrorhamnose 3,5-epimerase related
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
5-epimerase activity (GO:0008830)
Biological Process: lipopolysaccharide biosynthetic process (GO:0009103)

Curated
PM
AN syn rfbC (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 20843.2 Da
SQ 185 aa
 
........10........20........30........40........50
| | | | |
MKVIDTSLPGCFVIEPRVLGDERGQFFEAWNAERFDQHGFSARFLQSNIS
TSTKGVLRGLHYQWPRPQGKLVSVLEGEVYDVAVDIRRGSPYFGQWTAAI
LSAENNRQFWIPEGFAHGFAVLSERAVFSYLCTDIYVHDADASVRWDDAT
IGVDWPISSPILSAKDRAAPFLEDIAEERLPVYQG
Show or not Domain decomposition
 
X.species

NP_643890.1 lcl|rmlC-XAC3583

1

183

S=809 I=79 E=3.12074e-91

dTDP-4-dehydrorhamnose 3,5-epimerase

X.species

NP_636015.1 lcl|rmlC-XCC0623

1

184

S=789 I=77 E=7.00935e-89

dTDP-4-dehydrorhamnose 3,5-epimerase

X.species

lcl|rmlC-XALc_2695

1

184

S=787 I=79 E=1.21402e-88

probable dtdp-4-dehydrorhamnose 3,5-epimerase protein

X.species

YP_365438.1 lcl|rmlC-XCV3707

1

183

S=773 I=76 E=6.35771e-87

dTDP-4-dehydrorhamnose 3,5-epimerase

X.species

NP_637378.1 lcl|rfbD-XCC2013

6

170

S=321 I=40 E=3.72657e-32

strX protein

pubmed

1

184

S=789 I=77 E=2.66111e-87

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase

Pubmed 8253667,11589581

 

prodomImg

pubmed

1

183

S=749 I=73 E=1.98745e-82

DTDP-dehydrorhamnose 3,5-epimerase

Pubmed 16585771

 

prodomImg

pubmed

18

163

S=614 I=75 E=4.60861e-66

RfbD

Pubmed 18424531

 

prodomImg

pubmed

18

163

S=612 I=75 E=7.70857e-66

RfbD

Pubmed 18424531

 

prodomImg

pubmed

18

163

S=610 I=75 E=1.31205e-65

RfbD

Pubmed 18424531

 

prodomImg

sp

1

173

S=480 I=55 E=5.17157e-50

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

 

prodomImg

sp

1

166

S=470 I=53 E=9.68028e-49

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

 

prodomImg

sp

1

169

S=437 I=51 E=7.36302e-45

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

 

prodomImg

sp

1

180

S=403 I=46 E=1.18539e-40

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

 

prodomImg

sp

13

175

S=348 I=43 E=5.19269e-34

Probable dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Plasmid

 

prodomImg

Iprscan IPR014710 [G3DSA:2.60.120.10]

1

175

RmlC-like jelly roll fold

Iprscan IPR000888 [PTHR21047]

1

184

dTDP-4-dehydrorhamnose 3,5-epimerase related

Iprscan IPR000888 [PF00908]

4

174

dTDP-4-dehydrorhamnose 3,5-epimerase related

Iprscan IPR000888 [TIGR01221]

2

176

dTDP-4-dehydrorhamnose 3,5-epimerase related

PD001462

1

174

S=509 I=56 E=3.36029e-54

Iprscan IPR011051 [SSF51182]

1

175

Cupin, RmlC-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one h4E37GFT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

184 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYW4tLF/XFF4834R_chr34770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYW4tLF/XFF4834R_chr34770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYW4tLF/XFF4834R_chr34770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYW4tLF/XFF4834R_chr34770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.