Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34760rmlDXFF4834R_chr34760dTDP-4-dehydrorhamnose reductase

rmlD XFF4834R_chr34760
XFF4834R_chr34750
XFF4834R_chr34750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34770
XFF4834R_chr34770
ID rmlD
AC XFF4834R_chr34760
LT XFF4834R_chr34760
OR XFF4834R_chr from 4032314 to 4033213 on strand -
DE dTDP-4-dehydrorhamnose reductase
IP dTDP-4-dehydrorhamnose reductase
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Biological Process: extracellular polysaccharide biosynthetic process (GO:0045226)
Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: dTDP-4-dehydrorhamnose reductase activity (GO:0008831)

Curated
PM
AN syn rfbD (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 32015.8 Da
SQ 299 aa
 
........10........20........30........40........50
| | | | |
MTTLVIGASGQVGTELLRVLAPLGTVVAASRSGQLADGLSCERIDLNELA
SLDLALNRVRPALVVNAAAYTAVDRAEQERDAAFRANAEAPGVIAQWCAR
ADVPLVHYSTDYVFDGQGTRPYLPDDATAPLGVYGQSKLAGERAVQAAGG
RHLIFRTAWVYAAHGHNFLRTMLRVGAERDVLRVVADQIGTPTPAALIAD
ITAHALRQPGEPSGLWHLTAAGQTTWHGFAEAIFAQARARGLLARTPRVE
AIGTADYPTPAKRPAYSRLDTHSLQDTFGVRLPDWQDGLSQVLDTLAQR
XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

1

142

S=93 I=27 E=7.85814e-05

X.species

NP_643889.1 lcl|rmlD-XAC3582

1

299

S=1370 I=89 E=6.22568e-159

dTDP-4-keto-L-rhamnose reductase

X.species

YP_365437.1 lcl|rmlD-XCV3706

27

299

S=1260 I=89 E=1.33805e-145

dTDP-4-dehydrorhamnose reductase

X.species

lcl|rmlD-XALc_2694

1

299

S=1071 I=71 E=1.10255e-122

probable dtdp-4-dehydrorhamnose reductase protein

X.species

NP_636016.1 lcl|rmlD-XCC0624

1

297

S=1030 I=69 E=8.90656e-118

dTDP-4-dehydrorhamnose reductase

pubmed

1

299

S=1067 I=72 E=1.34188e-120

DTDP-4-dehydrorhamnose reductase

Pubmed 16585771

 

prodomImg

pubmed

1

297

S=1020 I=68 E=5.68148e-115

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Oxidoreductase

Pubmed 8253667,1370280

 

prodomImg

pubmed

1

293

S=684 I=49 E=3.45865e-74

dTDP-4-dehydrorhamnose reductase

Pubmed 17453174

 

prodomImg

pubmed

1

296

S=679 I=47 E=1.09326e-73

RmlD

Pubmed 17449692

 

prodomImg

pubmed

1

296

S=679 I=47 E=1.17224e-73

RmlD

Pubmed 16055280

 

prodomImg

sp

1

296

S=674 I=46 E=3.33426e-73

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

 

prodomImg

sp

1

296

S=664 I=46 E=5.15184e-72

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

 

prodomImg

sp

1

296

S=639 I=45 E=5.51019e-69

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

 

prodomImg

sp

1

296

S=632 I=45 E=4.62459e-68

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

 

prodomImg

sp

61

293

S=487 I=43 E=1.41629e-50

Probable dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; NADP Oxidoreductase Plasmid

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

223

NAD(P)-binding domain

Iprscan [PTHR10491]

1

298

-

Iprscan IPR005913 [PF04321]

1

297

dTDP-4-dehydrorhamnose reductase

Iprscan IPR005913 [TIGR01214]

2

296

dTDP-4-dehydrorhamnose reductase

PD158607

198

299

S=210 I=42 E=5.0172e-18

PD576929

111

165

S=163 I=63 E=2.52893e-12

PDA1W924

1

110

S=159 I=45 E=7.32641e-12

PDA9G8K9

4

219

S=135 I=27 E=7.24464e-09

PDA1E0R3

1

48

S=126 I=52 E=7.82947e-08

PDA296X9

50

110

S=120 I=52 E=4.75926e-07

PDA9J045

4

156

S=118 I=30 E=8.46152e-07

PDA6R6O3

53

110

S=106 I=40 E=2.40695e-05

PDA1Q157

32

110

S=102 I=33 E=6.85247e-05

Iprscan IPR016040 [SSF51735]

1

299

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sevlEkYl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

142 hits
swiss-prot

Swiss-Prot ncbi-blastp

15 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoxX1YR/XFF4834R_chr34760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoxX1YR/XFF4834R_chr34760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoxX1YR/XFF4834R_chr34760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoxX1YR/XFF4834R_chr34760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.