Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34740xanBXFF4834R_chr34740phosphomannose isomerase/GDP-D-mannose pyrophosphorylase

xanB XFF4834R_chr34740
XFF4834R_chr34730
XFF4834R_chr34730
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34750
XFF4834R_chr34750
ID xanB
AC XFF4834R_chr34740
LT XFF4834R_chr34740
OR XFF4834R_chr from 4029129 to 4030532 on strand +
DE phosphomannose isomerase/GDP-D-mannose pyrophosphorylase
IP Mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase; Cupin, RmlC-type
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: polysaccharide metabolic process (GO:0005976)
Biological Process: lipopolysaccharide biosynthetic process (GO:0009103)
Molecular Function: nucleotidyltransferase activity (GO:0016779)

Curated
PM
AN gene synomym manA, functional study in Xcc B100, annotated gene in NCBI AF204145, involved in GDP-D-mannose biosynthesis, precursors of exopolysaccharide and lipopolysaccharide
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110118)
MW 50898.2 Da
SQ 467 aa
 
........10........20........30........40........50
| | | | |
MSDVLPIILSGGSGTRLWPLSRESYPKQFLPLVGDKSMLQSTWLRAAPVA
GHAPIVVANEEHRFMAAEQLQQLGVKPSAILLEPKGRNTAPAIAVAALEA
IRDGADPLLLVLPSDHVIGNEAAFQAAVKVAAEAAAQGKLVTFGIKPTAP
ETGYGYIKAGAGTAASAVERFVEKPDLATAQSYLASGEYYWNSGMFLFRA
SRYLEELRKFHPAIADACQKAWENGKRDADFTRLDKDAFAASPSDSIDYA
VMEKTADAVVVPLDAGWNDVGSWSSLLDVSNQDAQGNAHHGDVIQLDCQN
TYAYGSRLIAMVGLEDVVVVETPDAVLVGHRDRIQEVKDVVSQIKTAGRS
EATWHRKVYRPWGAYDSIDMGQRHQVKRITVKPGAVLSLQMHHHRAEHWI
VVSGTAEVTRGEEVLLLTENQSTYIPLGVTHRLRNPGKLPLELIEVQSGS
YLGEDDIVRFEDTYGRA
X.species

YP_365435.1 lcl|xanB-XCV3704

1

467

S=2284 I=93 E=0

phosphomannose isomerase / gdpmannose dehydrogenase

X.species

NP_643887.1 lcl|xanB-XAC3580

1

467

S=2254 I=93 E=0

GDP-mannose pyrophosphorylase

X.species

NP_636017.1 lcl|xanB-XCC0625

1

466

S=2176 I=88 E=0

phosphomannose isomerase/GDP-mannose pyrophosphorylase

X.species

lcl|xanB-XALc_2693

1

466

S=2059 I=83 E=0

probable mannose-6-phosphate isomerase protein

X.species

NP_636010.1 lcl|wxcH-XCC0618

426

467

S=129 I=60 E=2.0529e-08

WxcH protein

pubmed

1

466

S=2174 I=88 E=0

Xanthan biosynthesis protein xanB EC=5.3.1.8 EC=2.7.7.13 ; Exopolysaccharide GTP-binding Isomerase Lipopolysaccharide Multifunctional enzyme Nucl

Pubmed 1370280,11589581

 

prodomImg

pubmed

1

467

S=1839 I=75 E=0

Phosphomannose isomerase/GDP-mannose pyrophosphorylase

Pubmed 16585771

 

prodomImg

pubmed

2

466

S=1422 I=58 E=2.29938e-163

Mannose-1-phosphate guanylyltransferase EC=2.7.7.13 ; Capsule biogenesis/degradation GTP-binding Lipopolysaccharide biosynthesis Nucleotide-binding

Pubmed 7815923,8759852

 

prodomImg

pubmed

2

466

S=1416 I=58 E=1.10454e-162

GDP-mannose pyrophosphorylase

Pubmed 11238967

 

prodomImg

pubmed

2

466

S=1416 I=58 E=1.15376e-162

GDP-mannose pyrophosphorylase

Pubmed 11238967

 

prodomImg

sp

1

466

S=2176 I=88 E=0

Xanthan biosynthesis protein xanB EC=5.3.1.8 EC=2.7.7.13 ; Exopolysaccharide GTP-binding Isomerase Lipopolysaccharide Multifunctional enzyme Nucleotide-b

 

prodomImg

sp

1

466

S=2174 I=88 E=0

Xanthan biosynthesis protein xanB EC=5.3.1.8 EC=2.7.7.13 ; Exopolysaccharide GTP-binding Isomerase Lipopolysaccharide Multifunctional enzyme Nucl

 

prodomImg

sp

2

466

S=1431 I=59 E=1.25691e-164

Mannose-1-phosphate guanylyltransferase 1 EC=2.7.7.13 ; GTP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

2

466

S=1422 I=58 E=1.5754e-163

Mannose-1-phosphate guanylyltransferase EC=2.7.7.13 ; Capsule biogenesis/degradation GTP-binding Lipopolysaccharide biosynthesis Nucleotide-binding

 

prodomImg

sp

2

466

S=1415 I=58 E=9.32905e-163

Mannose-1-phosphate guanylyltransferase manC EC=2.7.7.13 ; Capsule biogenesis/degradation GTP-binding Lipopolysaccharide biosynthesis Nucleotide-bi

 

prodomImg

Iprscan [G3DSA:3.90.550.10]

4

225

-

Iprscan IPR014710 [G3DSA:2.60.120.10]

366

446

RmlC-like jelly roll fold

Iprscan [PTHR12526:SF1]

4

458

-

Iprscan [PTHR12526]

4

458

-

Iprscan IPR005835 [PF00483]

6

285

Nucleotidyl transferase

Iprscan IPR001538 [PF01050]

312

462

Mannose-6-phosphate isomerase, type II, C-terminal

Iprscan IPR006375 [TIGR01479]

4

466

Mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase

Iprscan [seg]

90

100

-

Iprscan [seg]

121

137

-

PDA064F9

398

461

S=280 I=83 E=2.33117e-26

PD959980

197

281

S=270 I=60 E=3.82861e-25

PD002664

140

203

S=222 I=65 E=2.46343e-19

PDA4Y262

357

467

S=205 I=39 E=2.61409e-17

PDA4O8Z7

57

169

S=180 I=36 E=3.21446e-14

PD954878

325

373

S=172 I=61 E=2.36711e-13

PDA06084

359

400

S=162 I=68 E=4.7509e-12

PD114095

57

118

S=159 I=55 E=1.06886e-11

PD006861

5

49

S=150 I=63 E=1.26038e-10

PD522595

426

467

S=129 I=60 E=3.94284e-08

Iprscan IPR011051 [SSF51182]

212

465

Cupin, RmlC-type

Iprscan [SSF53448]

4

280

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GaRjWihA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

115 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDgyzNo/XFF4834R_chr34740.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDgyzNo/XFF4834R_chr34740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDgyzNo/XFF4834R_chr34740.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDgyzNo/XFF4834R_chr34740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.