Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34730xanAXFF4834R_chr34730phosphomannomutase/phosphoglucomutase

xanA XFF4834R_chr34730
XFF4834R_chr34720
XFF4834R_chr34720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34740
XFF4834R_chr34740
ID xanA
AC XFF4834R_chr34730
LT XFF4834R_chr34730
OR XFF4834R_chr from 4027736 to 4029082 on strand +
DE phosphomannomutase/phosphoglucomutase
IP Phosphoglucosamine mutase
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: magnesium ion binding (GO:0000287)
phosphotransferases (GO:0016868)

Curated
PM
AN gene synomym manB, functional study in Xcc B100, annotated gene in NCBI AF204145 involved in biosynthesis of UDP-D-glucose precursor of exopolysaccharide (xanthan) and lipopolysaccharide
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 48910.8 Da
SQ 448 aa
 
........10........20........30........40........50
| | | | |
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLAS
PALQEALSAGLRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNP
MDYNGMKLVREQARPISSDTGLFAIRDTVAADTAAPGEPTASEQSRTDKT
AYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIVDLLAPHLPFEFVRVFHE
PDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDGDFDRCFFFDHTG
RFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQS
GRSLADLVEARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTD
GISADFGQWRFNLRSSNTEPLLRLNVETRGDAALLETRTQEISNLLRG
XFF4834R

XFF4834R_chr38000 lcl|XFF4834R_chr41080444_4390789_r3_XFF4834R-XFF4834R_chr38000

6

446

S=551 I=37 E=4.62501e-60

XFF4834R

XFF4834R_chr27100 lcl|glmM-XFF4834R_chr27100

6

447

S=299 I=30 E=1.52877e-29

phosphoglucosamine mutase

X.species

NP_643886.1 lcl|xanA-XAC3579

1

448

S=2383 I=100 E=0

phosphoglucomutase

X.species

YP_365434.1 lcl|xanA-XCV3703

1

448

S=2367 I=99 E=0

phosphoglucomutase / phosphomannomutase

X.species

NP_636018.1 lcl|xanA-XCC0626

1

448

S=2254 I=97 E=0

phosphoglucomutase

X.species

lcl|xanA-XALc_2692

1

446

S=2093 I=89 E=0

probable phosphoglucomutase / phosphomannomutase protein

X.species

YP_365756.1 lcl|manB-XCV4025

6

446

S=558 I=37 E=2.11139e-60

phosphomannomutase

X.species

NP_639197.1 lcl|algC-XCC3857

6

438

S=552 I=37 E=1.07806e-59

phosphomannomutase

X.species

NP_644213.2 lcl|algC-XAC3912

6

446

S=549 I=36 E=2.96401e-59

phosphomannomutase

X.species

lcl|XALc_0375

1

434

S=536 I=36 E=1.16412e-57

putative phosphomannomutase/phosphoglucomutase protein

X.species

lcl|glmM-XALc_0989

6

427

S=301 I=30 E=2.89067e-29

probable phosphoglucosamine mutase protein

X.species

YP_364594.1 lcl|mrsA-XCV2863

6

447

S=297 I=30 E=8.37438e-29

phosphoglucosamine mutase

X.species

NP_643023.1 lcl|mrsA-XAC2714

6

447

S=294 I=30 E=2.34293e-28

phosphohexose mutase

X.species

NP_637887.1 lcl|mrsA-XCC2539

6

447

S=286 I=29 E=2.30051e-27

phosphohexose mutase

pubmed

1

448

S=2247 I=96 E=0

Phosphohexose mutases EC=5.4.2.2 EC=5.4.2.8 ; Exopolysaccharide synthesis Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosph

Pubmed 1370280

 

prodomImg

pubmed

1

447

S=1910 I=79 E=0

Phosphoglucomutase

Pubmed 12761084

 

prodomImg

pubmed

1

448

S=1761 I=75 E=0

Phosphomannomutase

Pubmed 16585771

 

prodomImg

pubmed

2

446

S=1414 I=60 E=1.82832e-162

Phosphomannomutase EC=5.4.2.8 ; Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

Pubmed 1383393

 

prodomImg

pubmed

3

447

S=1408 I=60 E=1.09216e-161

Phosphomannomutase

Pubmed 11238967,15375135

 

prodomImg

sp

1

448

S=2255 I=97 E=0

Phosphohexose mutases EC=5.4.2.2 EC=5.4.2.8 ; Exopolysaccharide synthesis Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

 

prodomImg

sp

1

448

S=2247 I=96 E=0

Phosphohexose mutases EC=5.4.2.2 EC=5.4.2.8 ; Exopolysaccharide synthesis Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosph

 

prodomImg

sp

2

446

S=1414 I=60 E=1.24342e-162

Phosphomannomutase EC=5.4.2.8 ; Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

 

prodomImg

sp

3

446

S=1395 I=60 E=2.51535e-160

Phosphomannomutase EC=5.4.2.8 ; Capsule biogenesis/degradation Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

 

prodomImg

sp

3

446

S=1372 I=58 E=1.70964e-157

Phosphomannomutase EC=5.4.2.8 ; Capsule biogenesis/degradation Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

 

prodomImg

Iprscan IPR005841 [PR00509]

90

104

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

167

186

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

201

214

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

230

245

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR016055 [G3DSA:3.40.120.10]

5

119

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan IPR016055 [G3DSA:3.40.120.10]

169

246

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan IPR016055 [G3DSA:3.40.120.10]

247

359

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan [PTHR22573:SF6]

244

439

-

Iprscan [PTHR22573]

244

439

-

Iprscan IPR005844 [PF02878]

5

130

Alpha-D-phosphohexomutase, alpha/beta/alpha domain I

Iprscan IPR005846 [PF02880]

254

365

Alpha-D-phosphohexomutase, alpha/beta/alpha domain III

Iprscan IPR005845 [PF02879]

151

250

Alpha-D-phosphohexomutase, alpha/beta/alpha domain II

Iprscan IPR005843 [PF00408]

370

446

Alpha-D-phosphohexomutase, C-terminal

Iprscan IPR016066 [PS00710]

91

100

Alpha-D-phosphohexomutase, conserved site

PD716604

333

390

S=198 I=64 E=1.92828e-16

PD000778

152

272

S=141 I=37 E=1.3764e-09

PD409668

110

151

S=134 I=86 E=9.96048e-09

PD001709

269

330

S=131 I=49 E=2.20218e-08

PDA1J4I9

6

64

S=131 I=48 E=2.36126e-08

PD247430

1

25

S=131 I=96 E=2.38194e-08

PDA550H7

110

161

S=118 I=51 E=7.85813e-07

PD347884

381

447

S=115 I=39 E=2.05038e-06

PDA7X3H9

1

21

S=115 I=100 E=2.29646e-06

PDA365U6

1

21

S=112 I=100 E=5.25748e-06

Iprscan IPR016055 [SSF53738]

1

174

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan IPR016055 [SSF53738]

254

361

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan IPR016055 [SSF53738]

149

253

Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III

Iprscan [SSF55957]

363

448

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ahtfJ2tb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

217 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1_de2Q/XFF4834R_chr34730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1_de2Q/XFF4834R_chr34730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1_de2Q/XFF4834R_chr34730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1_de2Q/XFF4834R_chr34730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.