Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34720lpsIXFF4834R_chr34720Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A

lpsI XFF4834R_chr34720
XFF4834R_chr34710
XFF4834R_chr34710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34730
XFF4834R_chr34730
ID lpsI
AC XFF4834R_chr34720
LT XFF4834R_chr34720
OR XFF4834R_chr from 4026870 to 4027601 on strand -
DE Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
IP Coenzyme A transferase
CL 1.6.3 Lipopolysaccharide GO:0009103
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: CoA-transferase activity (GO:0008410)

Curated
PM
AN gene synomym wxcI, functional study in Xcc B100, annotated gene in NCBI AF204145
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110118)
MW 25869.2 Da
SQ 243 aa
 
........10........20........30........40........50
| | | | |
MRSEGRGAASGKRYADAKAALSGVLANGQTLAVGGFGLCGIPEALIAAVR
DSGIGGLTVISNNAGVDGFGLGQLLATRQIRKMISSYVGENKEFERQYLA
GELELEFNPQGTLAERLRAGGAGIPAFYTATGYGTIVAEGKETREFDGKH
YVLETALQADVALVKAWRADTAGNLVFRKTARNFNPACAMAGRVCIAEVE
DIVELGVIDPDQVHLPGIYVDRLVLNATPEKRIEQRTVREGQQ
X.species

NP_643885.1 lcl|ipsI-XAC3578

1

243

S=1254 I=99 E=5.58812e-145

IpsJ protein

X.species

YP_365433.1 lcl|wxcI-XCV3702

1

243

S=1250 I=99 E=1.5771e-144

3-oxoacid CoA transferase alpha subunit

X.species

NP_636019.1 lcl|ipsI-XCC0627

1

243

S=1156 I=91 E=3.39523e-133

3-oxoadipate CoA-succinyl transferase alpha subunit

X.species

lcl|lpsI-XALc_2691

3

240

S=1073 I=85 E=3.90493e-123

probable succinyl-coa:3-ketoacid-coenzyme a transferase subunit a protein

X.species

lcl|pcaI-XALc_3033

12

231

S=507 I=50 E=1.65284e-54

probable 3-oxoadipate coa-transferase subunit a protein

pubmed

1

243

S=1156 I=91 E=1.60268e-131

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

Pubmed 9385134,11589581

 

prodomImg

pubmed

11

239

S=1025 I=86 E=1.17571e-115

3-oxoadipate CoA-succinyl transferase alpha subunit

Pubmed 16585771

 

prodomImg

pubmed

11

240

S=800 I=65 E=2.00838e-88

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5

Pubmed 8969509

 

prodomImg

pubmed

14

240

S=781 I=65 E=3.99259e-86

Probable succinyl CoA:3-oxoacid CoA-transferase, subunit A

Pubmed 15480790

 

prodomImg

pubmed

14

240

S=781 I=65 E=4.51092e-86

ScoA protein

Pubmed 14762003

 

prodomImg

sp

1

243

S=1156 I=91 E=9.2689e-132

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

 

prodomImg

sp

1

243

S=1156 I=91 E=1.09389e-131

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

 

prodomImg

sp

11

240

S=800 I=65 E=1.37079e-88

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5

 

prodomImg

sp

12

242

S=743 I=61 E=1.19574e-81

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5

 

prodomImg

sp

12

239

S=730 I=61 E=4.12057e-80

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A EC=2.8.3.5

 

prodomImg

Iprscan [G3DSA:3.40.1080.10]

11

224

-

Iprscan [PTHR13707:SF2]

35

239

-

Iprscan IPR004165 [PTHR13707]

35

239

Coenzyme A transferase

Iprscan IPR004165 [PF01144]

15

226

Coenzyme A transferase

Iprscan IPR004165 [SM00882]

14

226

Coenzyme A transferase

Iprscan IPR012792 [TIGR02429]

12

229

3-oxoacid CoA-transferase, subunit A

Iprscan IPR004163 [PS01273]

27

42

Coenzyme A transferase binding site

PD583163

53

105

S=214 I=77 E=1.88504e-18

PDA0K1U9

132

172

S=173 I=80 E=1.86089e-13

PD003187

173

224

S=173 I=73 E=2.0482e-13

PDA1F7I6

94

132

S=152 I=74 E=6.75148e-11

PDA6B0Q8

208

239

S=124 I=75 E=1.74197e-07

PDA1F7I7

12

53

S=118 I=52 E=7.21507e-07

Iprscan [SSF100950]

10

243

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jKhcXfFU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

39 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3vBeA1/XFF4834R_chr34720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3vBeA1/XFF4834R_chr34720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3vBeA1/XFF4834R_chr34720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3vBeA1/XFF4834R_chr34720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.