Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34710lpsJXFF4834R_chr34710acetyl-CoA:acetoacetyl-CoA transferase, beta subunit

lpsJ XFF4834R_chr34710
XFF4834R_chr34700
XFF4834R_chr34700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34720
XFF4834R_chr34720
ID lpsJ
AC XFF4834R_chr34710
LT XFF4834R_chr34710
OR XFF4834R_chr from 4026238 to 4026870 on strand -
DE acetyl-CoA:acetoacetyl-CoA transferase, beta subunit
IP Coenzyme A transferase
CL 1.6.3 Lipopolysaccharide GO:0009103
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: CoA-transferase activity (GO:0008410)

Curated
PM
AN gene synomym wxcJ, functional study in Xcc B100, annotated gene in NCBI AF204145
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110118)
MW 22210.4 Da
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MAWTRDQMAARAARELTDGAYVNLGIGLPTLVANHIPDGVDVWLQSENGL
LGIGPFPAENEVDADLINAGKQTVTARAGASYFGSHDSFAMIRGGHIDLA
ILGAMQVTERGDLANWMVPGKMVKGMGGAMDLVAGVKRVVVLMEHVAKDG
SHKILRECDLPLTGVGVVDRIITDLAVFDVTAEGLVLVEHADGVELEELR
NKTGVAFIAA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr03490 lcl|XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490

4

149

S=97 I=25 E=1.70047e-05

X.species

YP_365432.1 lcl|wxcJ-XCV3701

1

210

S=971 I=90 E=8.41385e-111

3-oxoacid CoA transferase beta subunit

X.species

NP_643884.1 lcl|ipsJ-XAC3577

1

207

S=923 I=88 E=5.04895e-105

IpsJ protein

X.species

NP_636020.1 lcl|ipsJ-XCC0628

1

208

S=913 I=87 E=7.73353e-104

IpsJ protein

X.species

lcl|lpsJ-XALc_2690

1

207

S=863 I=83 E=8.61839e-98

probable succinyl-coa:3-ketoacid-coenzyme a transferase subunit b protein

X.species

lcl|pcaJ-XALc_3032

5

207

S=496 I=49 E=2.81565e-53

probable 3-oxoadipate coa-transferase subunit b protein

X.species

YP_362110.1 lcl|gctB-XCV0379

4

145

S=105 I=29 E=7.06397e-06

glutaconate CoA transferase subunit B

X.species

NP_640721.1 lcl|gctB-XAC0365

4

113

S=95 I=31 E=9.49352e-05

glutaconate CoA transferase subunit B

pubmed

1

208

S=915 I=87 E=1.70111e-102

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

Pubmed 9385134

 

prodomImg

pubmed

1

203

S=665 I=64 E=3.2183e-72

Succinyl CoA:3-oxoadipate CoA transferase beta subunit

Pubmed 10742233

 

prodomImg

pubmed

1

210

S=636 I=64 E=1.18717e-68

Putative 3-oxoadipate succinyl-CoA transferase subunit B

Pubmed 17644649

 

prodomImg

pubmed

1

207

S=622 I=60 E=5.9519e-67

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5

Pubmed 8969509

 

prodomImg

pubmed

1

210

S=603 I=58 E=1.12291e-64

YxjE protein

Pubmed 11591669

 

prodomImg

sp

1

208

S=915 I=87 E=1.17854e-102

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

 

prodomImg

sp

1

208

S=913 I=87 E=2.07715e-102

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

 

prodomImg

sp

3

203

S=647 I=61 E=4.06241e-70

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5

 

prodomImg

sp

3

203

S=647 I=61 E=4.06241e-70

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5

 

prodomImg

sp

1

207

S=622 I=60 E=4.12352e-67

Probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5

 

prodomImg

Iprscan [G3DSA:3.40.810.20]

6

207

-

Iprscan IPR004165 [PTHR13707]

1

208

Coenzyme A transferase

Iprscan IPR004165 [PF01144]

5

198

Coenzyme A transferase

Iprscan IPR004165 [SM00882]

6

202

Coenzyme A transferase

Iprscan IPR012791 [TIGR02428]

3

209

3-oxoacid CoA-transferase, subunit B

Iprscan IPR004164 [PS01274]

44

52

Coenzyme A transferase active site

Iprscan [seg]

117

130

-

PD004976

6

207

S=678 I=66 E=1.23822e-74

PDA8S1F4

1

207

S=227 I=34 E=5.63635e-20

PD887852

131

207

S=150 I=36 E=9.52161e-11

Iprscan [SSF100950]

2

210

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HLRTXgTB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

61 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibQw_r/XFF4834R_chr34710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibQw_r/XFF4834R_chr34710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibQw_r/XFF4834R_chr34710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBibQw_r/XFF4834R_chr34710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.