Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34570XFF4834R_chr37680431_4012564_r3_XFF4834R-XFF4834R_chr34570XFF4834R_chr34570putative pectate lyase

XFF4834R_chr37680431_4012564_r3_XFF4834R-XFF4834R_chr34570 XFF4834R_chr34570
XFF4834R_chr34560
XFF4834R_chr34560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3674
XFF4834R_chr_3674
ID XFF4834R_chr37680431_4012564_r3_XFF4834R-XFF4834R_chr34570
AC XFF4834R_chr34570
LT XFF4834R_chr34570
OR XFF4834R_chr from 4011431 to 4012564 on strand -
DE putative pectate lyase
IP Pectate lyase/Amb allergen; Pectin lyase fold/virulence factor
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 40158.4 Da
SQ 377 aa
 
........10........20........30........40........50
| | | | |
MKPKFSTAAAASLFVGSLLLTGVAYADAALEVATTGWATQNGGTKGGSKA
AAANIYTVKNAAELKAALSASVGSNGRIIKVSGIIDISEGKPYTKTSDMK
TRARLDVPTKTTLIGITSNAEIREGYFYVKANDVIIRNITIENPWDLEPV
WDPDDGSAGNWNAEYDGLTVEGASNVWVDHVTFTDGRRTDDQNGTANGRP
KQHHDSAMDIKKGANFVTVSYSAFKSHEKNNLIGSSDSASSTDSGKLKVT
IHNTLFENISARAPRVRFGQVHLYNNYHVGSTSNAVYPFSHAHGVGKESK
IFSERNVFEIGGVSSCDKIAADYGGSVYRDQGSLLNGKALSCSWNTSIGW
TPPYTYNLLSADKVAADVKAKAGAGKL
X.species

NP_643869.1 lcl|pel-XAC3562

1

360

S=1749 I=92 E=0

pectate lyase

X.species

YP_365418.1 lcl|pel2-XCV3687

1

359

S=1718 I=91 E=0

Pectate lyase precursor

X.species

NP_636036.1 lcl|pel-XCC0644

1

360

S=1601 I=85 E=0

pectate lyase

X.species

NP_636037.2 lcl|pel-XCC0645

15

359

S=1429 I=78 E=5.02557e-166

pectate lyase

X.species

NP_638163.1 lcl|pelB-XCC2815

64

286

S=127 I=27 E=2.82339e-08

pectate lyase II

X.species

YP_364863.1 lcl|pel1-XCV3132

64

277

S=123 I=29 E=9.90895e-08

Pectate lyase precursor

X.species

NP_643295.1 lcl|pelB-XAC2986

166

277

S=122 I=32 E=1.36813e-07

pectate lyase II

pubmed

1

360

S=1678 I=87 E=0

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

Pubmed 8589419

 

prodomImg

pubmed

10

360

S=1430 I=75 E=1.84567e-164

Pectate lyase

Pubmed 17313166

 

prodomImg

pubmed

10

360

S=1427 I=75 E=4.11635e-164

Pectate lyase

Pubmed 17313166

 

prodomImg

pubmed

10

360

S=1422 I=74 E=1.52226e-163

Pectate lyase

Pubmed 17313166

 

prodomImg

pubmed

13

360

S=1418 I=75 E=4.81179e-163

Pectate lyase

Pubmed 17313166

 

prodomImg

sp

1

360

S=1678 I=87 E=0

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

 

prodomImg

sp

1

359

S=1374 I=73 E=7.02164e-158

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

 

prodomImg

sp

5

360

S=1356 I=73 E=1.03778e-155

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

 

prodomImg

sp

2

360

S=1349 I=73 E=7.70908e-155

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

 

prodomImg

sp

24

360

S=1304 I=73 E=2.26316e-149

Pectate lyase EC=4.2.2.2 ; Calcium Metal-binding Secreted Signal

 

prodomImg

Iprscan IPR012334 [G3DSA:2.160.20.10]

24

377

Pectin lyase fold

Iprscan IPR002022 [PF00544]

93

308

Pectate lyase/Amb allergen

Iprscan IPR002022 [SM00656]

51

314

Pectate lyase/Amb allergen

Iprscan [seg]

42

53

-

Iprscan [seg]

235

244

-

Iprscan [seg]

361

376

-

Iprscan [SignalP-NN(euk)]

1

28

-

PD117534

36

124

S=275 I=63 E=8.12637e-26

PD013757

308

359

S=263 I=92 E=2.41461e-24

PD968088

94

309

S=161 I=31 E=5.76676e-12

PDA1T5K9

1

35

S=151 I=91 E=9.30737e-11

PD718962

130

234

S=130 I=34 E=3.23275e-08

PD360712

246

286

S=128 I=62 E=4.82782e-08

PDA1I4I0

281

307

S=123 I=89 E=1.99964e-07

PDA1D790

118

165

S=123 I=51 E=2.22019e-07

Iprscan IPR011050 [SSF51126]

24

377

Pectin lyase fold/virulence factor

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SIiOYJKB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

37 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjso5Rt/XFF4834R_chr34570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjso5Rt/XFF4834R_chr34570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjso5Rt/XFF4834R_chr34570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjso5Rt/XFF4834R_chr34570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.