Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34330xpsJXFF4834R_chr34330Probable general secretion pathway protein J

xpsJ XFF4834R_chr34330
XFF4834R_chr34320
XFF4834R_chr34320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34340
XFF4834R_chr34340
ID xpsJ
AC XFF4834R_chr34330
LT XFF4834R_chr34330
OR XFF4834R_chr from 3968843 to 3969478 on strand -
DE Probable general secretion pathway protein J
IP
CL 4.3.A.5 The Type II (General) Secretory Pathway (IISP) Family GO:0015628 GO:0015447
EC
GO InterPro


Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 23122.3 Da
SQ 211 aa
 
........10........20........30........40........50
| | | | |
MSRWRSAGFTLIEVLLATMLLVGGLALAFATLRSASAVSQRGEAIAQRSE
RVRAVEEFLRRRLAAALPIAMGIDTQSQQPILFIGEPQRLRFAADVPDYL
GRGGPYLHDVSVAGDGDRRNLLIALTMLQSGKPIEESSPLPPETLAQGVQ
QVSFRYRGMDPQSGRLSAWLPQWEWHDRLPLMVRIDIRSDGAAWPPMVVA
LPQSSNPGAGQ
X.species

NP_643846.1 lcl|xpsJ-XAC3539

1

211

S=957 I=91 E=3.47718e-109

general secretion pathway protein J

X.species

YP_365394.1 lcl|xpsJ-XCV3663

1

211

S=943 I=89 E=1.74328e-107

general secretion pathway protein J

X.species

NP_636057.1 lcl|xpsJ-XCC0665

1

209

S=819 I=78 E=1.96212e-92

general secretion pathway protein J

X.species

lcl|xpsJ-XALc_2659

3

211

S=567 I=54 E=7.85705e-62

probable general secretion pathway protein j

pubmed

3

209

S=814 I=78 E=2.55881e-90

General secretion pathway protein J ; Methylation Transport

Pubmed 1944223

 

prodomImg

sp

3

209

S=814 I=78 E=1.7702e-90

General secretion pathway protein J ; Methylation Transport

 

prodomImg

Iprscan IPR012902 [TIGR02532]

6

29

Prepilin-type cleavage/methylation, N-terminal

Iprscan IPR001120 [PS00409]

7

27

Prokaryotic N-terminal methylation site

Iprscan [seg]

50

67

-

Iprscan [tmhmm]

7

29

-

PD858423

73

210

S=450 I=63 E=5.32268e-47

PD111001

3

72

S=123 I=53 E=2.22904e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2Vq7ugy3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKZJ510/XFF4834R_chr34330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKZJ510/XFF4834R_chr34330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKZJ510/XFF4834R_chr34330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKZJ510/XFF4834R_chr34330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.