Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34320xpsKXFF4834R_chr34320Probable general secretion pathway protein K

xpsK XFF4834R_chr34320
XFF4834R_chr34310
XFF4834R_chr34310
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34330
XFF4834R_chr34330
ID xpsK
AC XFF4834R_chr34320
LT XFF4834R_chr34320
OR XFF4834R_chr from 3967995 to 3968846 on strand -
DE Probable general secretion pathway protein K
IP General secretion pathway protein K
CL 4.3.A.5 The Type II (General) Secretory Pathway (IISP) Family GO:0015628 GO:0015447
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 30190.7 Da
SQ 283 aa
 
........10........20........30........40........50
| | | | |
MSRARGAALVLVLWLIALLTAMIGAFALTARVEALQGSMLRNGAQAQEYA
RSGLEYALFRLQDADTQARWRPDGRRYRWQMDDASVEIRITDESGKVDLN
MAEPTLLAGLVRAVGGEQASAGRIAGAIVDWRDGDSLSQPGGGAEDRDYA
DAGLPYGAKDSPFETLGELRLVLGIDGELYRKLLPNVTLYSGRSRPEARF
APAPVLTAMGLDAQQLLAQRDAPLGLPGNEATVGGSGTYSIESRARLSQG
REAVLRAVVSTSASALPGSAYTVLRWEEGAAVQ
XFF4834R

XFF4834R_chr07110 lcl|XFF4834R_chr07440056_0816045_f1_XFF4834R-XFF4834R_chr07110

73

227

S=120 I=30 E=3.58592e-08

X.species

NP_643845.1 lcl|xpsK-XAC3538

1

283

S=1327 I=94 E=8.29989e-154

general secretion pathway protein K

X.species

YP_365393.1 lcl|xpsK-XCV3662

1

283

S=1322 I=94 E=3.20613e-153

general secretion pathway protein K

X.species

NP_636058.1 lcl|xpsK-XCC0666

22

283

S=1168 I=88 E=1.74424e-134

general secretion pathway protein K

X.species

lcl|xpsK-XALc_2658

3

283

S=875 I=65 E=5.12625e-99

probable general secretion pathway protein k

X.species

YP_362494.1 lcl|xcsK-XCV0763

78

227

S=106 I=29 E=7.86481e-06

type II secretion system protein K

X.species

NP_641055.1 lcl|xcsK-XAC0702

81

227

S=105 I=30 E=1.12444e-05

type II secretion system protein K

pubmed

193

279

S=184 I=51 E=1.08829e-13

Putative uncharacterized protein

Pubmed 17263848

 

prodomImg

pubmed

110

188

S=144 I=41 E=7.13145e-09

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

Pubmed 8326859

 

prodomImg

pubmed

106

189

S=141 I=39 E=1.61849e-08

Type II secretion pathway related protein Type II secretion protein ; Plasmid

Pubmed 9722640,9628576

 

prodomImg

pubmed

106

189

S=141 I=39 E=1.61849e-08

W0029 EtpK protein ; Plasmid

Pubmed 9084155,11401985

 

prodomImg

pubmed

70

188

S=126 I=32 E=9.74466e-07

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

Pubmed 2129543,2162463

 

prodomImg

pubmed

79

209

S=114 I=30 E=3.27136e-05

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

Pubmed 1588814

 

prodomImg

sp

22

283

S=1168 I=88 E=4.45693e-133

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

110

188

S=144 I=41 E=4.86818e-09

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

70

188

S=126 I=32 E=6.65205e-07

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

79

209

S=114 I=30 E=2.23315e-05

General secretion pathway protein K ; Cell inner membrane Transmembrane Transport

 

prodomImg

Iprscan IPR005628 [PF03934]

1

283

General secretion pathway protein K

Iprscan [seg]

7

21

-

Iprscan [tmhmm]

7

29

-

PD861661

171

283

S=433 I=76 E=6.23975e-45

PD858347

1

103

S=184 I=46 E=8.54989e-15

PDA1Q730

38

171

S=141 I=31 E=1.39952e-09

PD119609

109

170

S=119 I=42 E=6.53829e-07

PD795243

162

278

S=118 I=35 E=7.78384e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 94x4wJS8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8a_TvG/XFF4834R_chr34320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8a_TvG/XFF4834R_chr34320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8a_TvG/XFF4834R_chr34320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8a_TvG/XFF4834R_chr34320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.