Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34300xpsMXFF4834R_chr34300General secretion pathway protein M

xpsM XFF4834R_chr34300
XFF4834R_chr34290
XFF4834R_chr34290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34310
XFF4834R_chr34310
ID xpsM
AC XFF4834R_chr34300
LT XFF4834R_chr34300
OR XFF4834R_chr from 3966240 to 3966893 on strand -
DE General secretion pathway protein M
IP General secretion pathway protein M
CL 4.3.A.5 The Type II (General) Secretory Pathway (IISP) Family GO:0015628 GO:0015447
EC
GO InterPro


Curated
PM
AN preuve fonctionnelle chez orthologue xcc (identite 90 sur toute la longueur) systeme de secretion de type II
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20100520)
MW 23784 Da
SQ 217 aa
 
........10........20........30........40........50
| | | | |
MPRSVKRDRWIALGLLLLVIGVAYLVLVHPWFTQPMIAVQDDLQALRERE
LRVRVQLQQAPEVSKRLRQARQTLESRPGFLPETSAELASAGLVQRLERA
VVEASPGNRSCAISNRSPLQPESKNRFTRVAVQVRLRCGTPELASVLYSL
ENGTPRLFVDNLNVMAQRYQLSPNESGNGLDIAFELAGYLRPGASAAPLN
NEAAPAAPNAAEASNAP
Show or not Domain decomposition
 
X.species

YP_365391.1 lcl|xpsM-XCV3660

1

193

S=785 I=81 E=2.81833e-88

general secretion pathway protein M

X.species

NP_643843.1 lcl|xpsM-XAC3536

4

193

S=772 I=81 E=9.71208e-87

general secretion pathway protein M

X.species

NP_636060.1 lcl|xpsM-XCC0668

1

193

S=746 I=77 E=1.38507e-83

general secretion pathway protein M

X.species

lcl|xpsM-XALc_2656

1

192

S=566 I=61 E=9.18543e-62

putative general secretion pathway protein m

pubmed

4

193

S=726 I=76 E=1.4222e-79

Protein xpsM

Pubmed 1313415

 

prodomImg

sp

4

193

S=726 I=76 E=9.83092e-80

Protein xpsM

 

prodomImg

Iprscan IPR019677 [PF10741]

76

190

General secretion pathway protein M

Iprscan [seg]

11

28

-

Iprscan [seg]

43

60

-

Iprscan [seg]

194

217

-

Iprscan [SignalP-NN(euk)]

1

25

-

Iprscan [tmhmm]

11

33

-

PD110875

61

175

S=300 I=56 E=7.83423e-29

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mj7oFy0p)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFpyn31/XFF4834R_chr34300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFpyn31/XFF4834R_chr34300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFpyn31/XFF4834R_chr34300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFpyn31/XFF4834R_chr34300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.