Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34290xpsNXFF4834R_chr34290general secretion pathway protein N

xpsN XFF4834R_chr34290
XFF4834R_chr34280
XFF4834R_chr34280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34300
XFF4834R_chr34300
ID xpsN
AC XFF4834R_chr34290
LT XFF4834R_chr34290
OR XFF4834R_chr from 3965459 to 3966250 on strand -
DE general secretion pathway protein N
IP
CL 4.3.A.5 The Type II (General) Secretory Pathway (IISP) Family GO:0015628 GO:0015447
EC
GO InterPro


Curated
PM
AN preuve fonctionnelle chez orthologue identite 80 sur 100 longueur homolgue caracterise chez xcc Involved in a general secretion pathway (GSP) for the export of proteins. peptide signal et domaine transmmembranaire
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20100520)
MW 27804.4 Da
SQ 263 aa
 
........10........20........30........40........50
| | | | |
MRLDMIGLRTWLLATVVGWALLVCVLAVAGLGKRVELLPDDPALVQRLPT
LPAPAPERLGAFEKYSEIAAHPAFAEDRLPHPFFLSGNDGGTAASTVRLT
GVLLTDNFKMATLTLDPQDSVRVQLGGEAVKGWRLLALQPRSATVEGPSG
TQTLELHVFNGQGGQPPTANAAARGAATATPPVPSPDAAALAPPQPPQPQ
PVAPVQQPGGQAPPTVPPQRSDGAQEAPRPSDDQMRAIRERIEARRRQLQ
QQRQSGSTPGQTQ
Show or not Domain decomposition
 
X.species

NP_643842.1 lcl|xpsN-XAC3535

1

263

S=786 I=65 E=2.79158e-88

general secretion pathway protein N

X.species

YP_365390.1 lcl|xpsN-XCV3659

1

165

S=728 I=87 E=3.00186e-81

general secretion pathway protein N

X.species

YP_365390.1 lcl|xpsN-XCV3659

220

263

S=106 I=57 E=7.10492e-06

general secretion pathway protein N

X.species

NP_636061.1 lcl|xpsN-XCC0669

1

165

S=672 I=81 E=1.8156e-74

general secretion pathway protein N

X.species

NP_636061.1 lcl|xpsN-XCC0669

220

263

S=97 I=52 E=9.22129e-05

general secretion pathway protein N

X.species

lcl|xpsN-XALc_2655

1

165

S=444 I=56 E=8.23481e-47

probable general secretion pathway protein n

pubmed

1

165

S=672 I=81 E=6.72265e-73

General secretion pathway protein N ; Cell inner membrane Transmembrane Transport

Pubmed 10692359

 

prodomImg

sp

1

165

S=672 I=81 E=4.63692e-73

General secretion pathway protein N ; Cell inner membrane Transmembrane Transport

 

prodomImg

Iprscan [coil]

232

256

-

Iprscan [seg]

16

32

-

Iprscan [seg]

166

219

-

Iprscan [seg]

236

254

-

Iprscan [SignalP-NN(euk)]

1

32

-

Iprscan [tmhmm]

7

29

-

PD046566

1

165

S=696 I=85 E=7.46436e-77

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ndq2fRW4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlsNRti/XFF4834R_chr34290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlsNRti/XFF4834R_chr34290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlsNRti/XFF4834R_chr34290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBlsNRti/XFF4834R_chr34290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.