Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34000XFF4834R_chr36840730_3924717_r1_XFF4834R-XFF4834R_chr34000XFF4834R_chr34000putative TonB-dependent transporter

XFF4834R_chr36840730_3924717_r1_XFF4834R-XFF4834R_chr34000 XFF4834R_chr34000
XFF4834R_chr_3609
XFF4834R_chr_3609
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34010
XFF4834R_chr34010
ID XFF4834R_chr36840730_3924717_r1_XFF4834R-XFF4834R_chr34000
AC XFF4834R_chr34000
LT XFF4834R_chr34000
OR XFF4834R_chr from 3921730 to 3924717 on strand -
DE putative TonB-dependent transporter
IP TonB-dependent vitamin B12 receptor; Bacterial TonB-dependent receptor
CL 4.1.B.14 The Outer Membrane Receptor (OMR) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: receptor activity (GO:0004872)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20120326)
MW 107503.8 Da
SQ 995 aa
 
........10........20........30........40........50
| | | | |
MQRFDPYRMHLSVLAVAIAACSPAVQAQTVGVSSDAVGLASPIRPDTASS
NEGQRPTETASVAEHPSDTASTTSRNDAAGREAPTAAGPESGVKTLDAMQ
VTGVRRANAAAVESKRAATNITDVISATDVRALPDSTIVEALRRVPGLSV
LPATDNEHPRDEAATPVLRGLGPSYNNVTIDGLTIASPGTPNGTLGSITR
GVRLDLLPASMVSELQVVKTFTPDLDPNATGGAINLKTRSAFENGGKPFF
SAEAALGHANDVGKPRDQNDPGYRVNATGSRTFGSEQQYGVTVSANYQTL
SSYTETHMTTDTVHYGFYDNSGVLQTGDSLGNGWAVPQQDKYWYVQDQRD
RYGLTGKFEMRPSAALEAYAMAGYYYFKDDMERNEVIIDPRNRGRVFNQT
ATSGSYPGGDIEVGYSNQIVTTRTKVAQLGTIWRPTDRQQFSARGAWSDA
TYDEPIRMIKYATGITRPAPVPVGQTGSGVTVNATPNYAFNYDTSGFDQR
FGVSPQAYNNLDNYSLSYWRPDYKRTASDRILTGRLDYGFNQGESDQGIG
FAAGVSYTTDKPSYEIYRVEYQPNTTAPAFGLADVVGTGRAPMRYAGLNL
LSIDPDKANRVLAATPSSAFNSTDQQAFSNQDNFTHTEKTFGSYGLISYR
SDRLNVQAGVHFDSTKLDTVGRQRQLDAATNHYVYVDNPTSADYGYLLPS
AVMTYHLTDALDLRAGASRTLGRPPYDAYAARTSIGFVNTTDAGNPNAQG
VTVTIGNRDIKPRVSNNLDLSLEWRLPGDFDAFASAAVFDKHIQDEIFTL
SRTDSFTFDGTTYANALISTPANAAKARIRGVEFNGIVSTLGPIAPWLSG
VGFSANLALLDGSLDVPYSVGSGSSLTQRERKLDNLVGQPDYTANATLFY
NAGGLELRAAYNRQGKALRSIVSNIDWQDLYWSPRSQLDFTATYAVSKQL
SVIGQVSNITHSRITSVTGPGQNLLKDSYSVPTTYWVGLRFTPTL
XFF4834R

XFF4834R_chr00440 XFF4834R_chr00420051_0055615_r3_XFF4834R-XFF4834R_chr00440

95

989

S=447 I=26 E=4.19088e-47

XFF4834R

XFF4834R_chr40010 XFF4834R_chr_4619037_4621922_f3_XFF4834R-XFF4834R_chr40010

84

960

S=345 I=26 E=8.55525e-35

XFF4834R

XFF4834R_chr25310 XFF4834R_chr27680813_2922371_r2_XFF4834R-XFF4834R_chr25310

96

388

S=215 I=31 E=5.4115e-19

XFF4834R

XFF4834R_chr25310 XFF4834R_chr27680813_2922371_r2_XFF4834R-XFF4834R_chr25310

629

990

S=186 I=26 E=1.91106e-15

XFF4834R

XFF4834R_chr08170 XFF4834R_chr_0948714_0951485_f3_XFF4834R-XFF4834R_chr08170

93

406

S=208 I=29 E=3.55798e-18

XFF4834R

XFF4834R_chr08170 XFF4834R_chr_0948714_0951485_f3_XFF4834R-XFF4834R_chr08170

615

960

S=152 I=26 E=2.30741e-11

XFF4834R

XFF4834R_chr16330 XFF4834R_chr17580884_1890231_f1_XFF4834R-XFF4834R_chr16330

77

366

S=208 I=27 E=4.16256e-18

XFF4834R

XFF4834R_chr16330 XFF4834R_chr17580884_1890231_f1_XFF4834R-XFF4834R_chr16330

818

960

S=103 I=31 E=1.96242e-05

XFF4834R

XFF4834R_chr27440 XFF4834R_chr_3172890_3175826_r2_XFF4834R-XFF4834R_chr27440

685

970

S=199 I=28 E=4.12298e-17

XFF4834R

XFF4834R_chr27440 XFF4834R_chr_3172890_3175826_r2_XFF4834R-XFF4834R_chr27440

96

247

S=160 I=29 E=2.54179e-12

X.species

NP_641482.2 fecA-XAC1146

1

995

S=5036 I=96 E=0

TonB-dependent receptor

X.species

YP_362896.1 XCV1165

1

995

S=4856 I=93 E=0

TonB-dependent outer membrane receptor

X.species

NP_636416.2 fecA-XCC1041

91

995

S=4459 I=92 E=0

TonB-dependent receptor

X.species

NP_636416.2 fecA-XCC1041

1

45

S=136 I=64 E=7.25422e-09

TonB-dependent receptor

X.species

XALc_0646 XALc_0646

73

995

S=3761 I=75 E=0

putative tonb-dependent outer membrane receptor protein

X.species

NP_639391.1 fecA-XCC4052

86

991

S=599 I=28 E=5.75086e-65

TonB-dependent receptor

X.species

YP_361781.1 XCV0050

95

989

S=466 I=26 E=7.63257e-49

TonB-dependent outer membrane receptor

X.species

NP_640430.2 cirA-XAC0074

95

989

S=449 I=26 E=9.231e-47

TonB-dependent receptor

X.species

NP_644430.1 XAC4131-XAC4131

84

960

S=361 I=27 E=4.24665e-36

hypothetical protein

X.species

YP_365955.1 XCV4224

93

960

S=340 I=27 E=1.27181e-33

TonB-dependent outer membrane receptor

pubmed

96

380

S=202 I=25 E=3.09945e-15

TonB ; Cell membrane box

Pubmed 11302501

 

prodomImg

pubmed

96

298

S=201 I=31 E=4.62876e-15

FecA ; Cell membrane TonB box

Pubmed 17574998

 

prodomImg

pubmed

96

257

S=190 I=31 E=1.04962e-13

TonB-dependent receptor ; Cell membrane box

Pubmed 16457898,18671744

 

prodomImg

pubmed

92

240

S=129 I=26 E=2.65247e-06

Putative TonB-dependent receptor protein

Pubmed 16980464

 

prodomImg

pubmed

93

187

S=126 I=34 E=4.67491e-06

Putative siderophore receptor

Pubmed 16134895

 

prodomImg

Iprscan IPR012910 [G3DSA:2.170.130.10]

89

238

TonB-dependent receptor, plug

Iprscan IPR000531 [G3DSA:2.40.170.20]

422

991

TonB-dependent receptor, beta-barrel

Iprscan IPR000531 [PF00593]

699

992

TonB-dependent receptor, beta-barrel

Iprscan IPR012910 [PF07715]

115

233

TonB-dependent receptor, plug

Iprscan IPR010104 [TIGR01782]

96

993

Bacterial TonB-dependent receptor

Iprscan [PS51257]

1

21

-

Iprscan [seg]

779

790

-

Iprscan [SignalP-NN(euk)]

1

27

-

PD678669

333

589

S=954 I=71 E=6.70486e-108

PD911069

590

674

S=435 I=96 E=4.81253e-45

PD897298

844

967

S=370 I=59 E=4.19444e-37

PDA2I626

1

84

S=278 I=68 E=5.94198e-26

PDA3G1M3

542

589

S=229 I=90 E=4.75437e-20

PDA1T5J5

961

995

S=185 I=100 E=1.08392e-14

PDA1W1R5

299

332

S=161 I=91 E=7.62868e-12

PD461487

90

273

S=149 I=29 E=2.51674e-10

PD481006

115

194

S=138 I=41 E=5.00736e-09

PDA1S621

93

122

S=136 I=93 E=7.81125e-09

Iprscan [SSF56935]

96

992

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7SnbnA8d)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

35 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbfTFnk/XFF4834R_chr34000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbfTFnk/XFF4834R_chr34000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbfTFnk/XFF4834R_chr34000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbfTFnk/XFF4834R_chr34000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.