Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33290katEXFF4834R_chr33290catalase

katE XFF4834R_chr33290
XFF4834R_chr33280
XFF4834R_chr33280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3522
XFF4834R_chr_3522
ID katE
AC XFF4834R_chr33290
LT XFF4834R_chr33290
OR XFF4834R_chr from 3829570 to 3831678 on strand +
DE catalase
IP Catalase-like domain, haem-dependent
CL 5.6.2 Detoxification (xenobiotic metabolism) GO:0006805
EC
GO InterPro
Biological Process: response to oxidative stress (GO:0006979)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: catalase activity (GO:0004096)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: heme binding (GO:0020037)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100830)
MW 76503.4 Da
SQ 702 aa
 
........10........20........30........40........50
| | | | |
MAKSPSKSAQLPALAPASATVDVSRGTGDELHQKAGGTHPQLTTNQGIPV
GDNQNSLRATPRGPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYF
ELTKSLSQYTTAKIFTEVGEKTPLFTRFSTVAGGAGSVDTPRDVRGFAVK
FYTKEGNWDLVGNNIPVFFIQDAMKFPDLIHAVKMEPDRGFPQAASAHDT
FWDFISLTPESMHMVMWAMSDRTIPRSLRMIEGFGIHSFRFLNDKGESTF
VKFHWRPKLGLQSTIWDEAVKIAGADQDFHRRDLFEAIQNGDFPEWELGV
QLFTQAQAETFPFDHLDSTKVIPEELVPLQIVGRMVLDRWPDNFFAETEQ
VAYCPANIVPGIDFSNDPLLQGRLFSYLDTQLSRLGGPNFHQIPINTPKC
PFANNQRDGHMQMGVPKGRVAYEPSSLQADAPREALRGFPSHATPAEEGA
KGRVRAESFADHYSQARLFFRSQTAPEQAHIASALVFELSKVETAHVREA
IVGHLRHIDQELAQRVADGMGMTALPPAPPAAVAPIDMPLSPALQVIGKM
KDTLKGRTVGILIHDGSDAAAIKAVRKAAEAAGATVKIVAPKLGGAKLND
GKQLAADGQLAGTPSVVFDAVAVLLSSEAAKLLTRESAALDFVSFAWAHL
KAIAFDEGAQSLLKAGNVGKDAGVVPAADTKAFIAAAKTRQWAREPKVRM
LA
XFF4834R

XFF4834R_chr38960 XFF4834R_chr42100511_4487034_r1_XFF4834R-XFF4834R_chr38960

42

519

S=903 I=42 E=1.41569e-102

X.species

NP_641547.1 katE-XAC1211

20

702

S=3326 I=92 E=0

catalase

X.species

YP_362971.1 katE-XCV1240

1

702

S=3303 I=89 E=0

catalase

X.species

NP_636484.1 katE-XCC1109

25

702

S=3187 I=88 E=0

catalase

X.species

NP_639288.1 catB-XCC3949

42

519

S=905 I=42 E=2.99821e-102

catalase precursor

X.species

XALc_2991 catB-XALc_2991

36

495

S=905 I=42 E=3.3e-102

probable catalase precursor protein

X.species

YP_365853.1 catB-XCV4122

42

428

S=900 I=47 E=1.4784e-101

catalase precursor

X.species

NP_644328.1 catB-XAC4029

134

519

S=656 I=39 E=5.77205e-72

catalase precursor

X.species

NP_644329.1 catB-XAC4030

42

126

S=229 I=55 E=3.08159e-20

catalase

X.species

NP_639245.1 srpA-XCC3905

87

377

S=169 I=26 E=5.16924e-13

catalase

X.species

XALc_0265 XALc_0265

87

380

S=167 I=24 E=8.95316e-13

hypothetical catalase precursor protein

X.species

YP_365814.1 srpA-XCV4083

87

377

S=147 I=24 E=2.47897e-10

catalase

X.species

NP_644290.1 srpA-XAC3990

87

377

S=137 I=23 E=3.93182e-09

catalase

pubmed

1

702

S=3326 I=90 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 10675038

 

prodomImg

pubmed

24

702

S=3221 I=89 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 8655557

 

prodomImg

pubmed

25

671

S=2011 I=60 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 18838821

 

prodomImg

pubmed

24

700

S=2011 I=58 E=0

Catalase C EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Plasmid

Pubmed 10198032,11481431

 

prodomImg

pubmed

30

675

S=1779 I=54 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 14555490

 

prodomImg

sp

24

700

S=2011 I=58 E=0

Catalase C EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Plasmid

 

prodomImg

sp

42

675

S=1731 I=54 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

 

prodomImg

sp

34

655

S=1716 I=54 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

 

prodomImg

sp

34

655

S=1668 I=53 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

 

prodomImg

sp

41

675

S=1663 I=51 E=0

Catalase EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

 

prodomImg

Iprscan IPR018028 [PR00067]

56

79

Catalase related subgroup

Iprscan IPR018028 [PR00067]

119

137

Catalase related subgroup

Iprscan IPR018028 [PR00067]

140

157

Catalase related subgroup

Iprscan IPR018028 [PR00067]

159

177

Catalase related subgroup

Iprscan IPR018028 [PR00067]

328

355

Catalase related subgroup

Iprscan IPR018028 [PR00067]

360

386

Catalase related subgroup

Iprscan IPR011614 [G3DSA:2.40.180.10]

30

539

Catalase, N-terminal

Iprscan [G3DSA:3.40.50.880]

548

695

-

Iprscan IPR020835 [PTHR11465]

118

675

Catalase-like domain, haem-dependent

Iprscan IPR018028 [PF00199]

43

429

Catalase related subgroup

Iprscan IPR010582 [PF06628]

453

521

Catalase-related immune responsive

Iprscan IPR002226 [PS00437]

373

381

Catalase

Iprscan IPR002226 [PS00438]

79

95

Catalase

Iprscan IPR011614 [PS51402]

39

526

Catalase, N-terminal

Iprscan [seg]

4

19

-

Iprscan [seg]

524

535

-

Iprscan [seg]

569

590

-

Iprscan [seg]

677

689

-

PD000510

33

522

S=1374 I=54 E=7.17275e-159

PDA7Q7T1

41

99

S=158 I=47 E=1.51713e-11

PD772939

562

672

S=154 I=38 E=5.05313e-11

PDA0C3F7

164

388

S=137 I=28 E=6.16488e-09

PDA1M4Z5

519

561

S=126 I=63 E=1.16406e-07

PD005049

591

669

S=108 I=39 E=2.04821e-05

Iprscan IPR020835 [SSF56634]

36

555

Catalase-like domain, haem-dependent

Iprscan [SSF52317]

554

698

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wR9SeXKE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

322 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6yqVF/XFF4834R_chr33290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6yqVF/XFF4834R_chr33290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6yqVF/XFF4834R_chr33290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6yqVF/XFF4834R_chr33290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.