Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33230XFF4834R_chr35910521_3821539_f2_XFF4834R-XFF4834R_chr33230XFF4834R_chr33230Putative peptidyl dipeptidase precursor

XFF4834R_chr35910521_3821539_f2_XFF4834R-XFF4834R_chr33230 XFF4834R_chr33230
XFF4834R_chr33220
XFF4834R_chr33220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33240
XFF4834R_chr33240
ID XFF4834R_chr35910521_3821539_f2_XFF4834R-XFF4834R_chr33230
AC XFF4834R_chr33230
LT XFF4834R_chr33230
OR XFF4834R_chr from 3819521 to 3821539 on strand +
DE Putative peptidyl dipeptidase precursor
IP Peptidase M2, peptidyl-dipeptidase A
CL 1.2.3 Proteins/peptides/glycopeptides GO:0006508 GO:0009050
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: peptidyl-dipeptidase activity (GO:0008241)
Molecular Function: metallopeptidase activity (GO:0008237)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120406)
MW 74632.7 Da
SQ 672 aa
 
........10........20........30........40........50
| | | | |
MNPRLLLLALAVAAGTLSLSACRRDAAPPDKPVATKTAPAESADQFVARI
SAEYKAAYPETTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQ
YAGTPMSADSARALQLLKLMSALPAPRDPAKLAELTRIAAKMEGDYGAGS
YCVGEGEQRRCRQLGELEQVLASSRDYNEQLDAWQGWHSTAQPMRKDYQR
FVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLWEQVKPLYAQL
QCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNAGGDGGAAARFNAEREAQLRTAKQMT
ERAQDFYTSLGMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQ
NIGADVRTKMCIKPTEEDFTTIYHELGHIYYDLAYNPLPPLFQNGANDGF
HEAIGDTIVLAMTPKYLQSIGMVGEQQTGRESLINSQMRMALSKVAFLPF
GLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSARGEEFFDPGA
KYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSDWLKQQNQGQ
MCGWQATAATPATTKTAPAAAR
pubmed

106

655

S=2791 I=94 E=0

Putative dipeptidyl carboxypeptidase

Pubmed 15195942

 

prodomImg

pubmed

33

654

S=867 I=34 E=5.65442e-96

Angiotensin-converting enzyme 2 EC=3.4.17.- ; Carboxypeptidase Cell membrane Chloride Disulfide bond Glycoprotein Hydrolase Metal-binding Metallop

Pubmed 15452268,12075344

 

prodomImg

pubmed

345

654

S=841 I=51 E=6.48461e-93

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

Pubmed 7811282

 

prodomImg

pubmed

345

654

S=778 I=46 E=3.46849e-85

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

Pubmed 7811282

 

prodomImg

pubmed

131

312

S=334 I=38 E=2.23956e-31

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

Pubmed 7811282

 

prodomImg

pubmed

36

312

S=319 I=32 E=1.24664e-29

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

Pubmed 7811282

 

prodomImg

pubmed

345

654

S=821 I=49 E=1.8592e-90

Angiotensin-converting enzyme, somatic isoform EC=3.4.15.1 ; Alternative splicing Carboxypeptidase Cell membrane Glycoprotein Hydrolase Metal-bin

Pubmed 2545691

 

prodomImg

pubmed

345

654

S=799 I=46 E=7.89151e-88

Angiotensin-converting enzyme, somatic isoform EC=3.4.15.1 ; Alternative splicing Carboxypeptidase Cell membrane Glycoprotein Hydrolase Metal-bin

Pubmed 2545691

 

prodomImg

pubmed

38

312

S=328 I=30 E=9.19554e-31

Angiotensin-converting enzyme, somatic isoform EC=3.4.15.1 ; Alternative splicing Carboxypeptidase Cell membrane Glycoprotein Hydrolase Metal-bin

Pubmed 2545691

 

prodomImg

pubmed

24

312

S=327 I=31 E=1.43446e-30

Angiotensin-converting enzyme, somatic isoform EC=3.4.15.1 ; Alternative splicing Carboxypeptidase Cell membrane Glycoprotein Hydrolase Metal-bin

Pubmed 2545691

 

prodomImg

sp

33

654

S=867 I=34 E=3.8917e-96

Angiotensin-converting enzyme 2 EC=3.4.17.- ; Carboxypeptidase Cell membrane Chloride Disulfide bond Glycoprotein Hydrolase Metal-binding Metallop

 

prodomImg

sp

33

654

S=845 I=33 E=1.68092e-93

Angiotensin-converting enzyme 2 EC=3.4.17.- ; Carboxypeptidase Cell membrane Chloride Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotea

 

prodomImg

sp

345

654

S=841 I=51 E=4.46308e-93

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

 

prodomImg

sp

345

654

S=778 I=46 E=2.38722e-85

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

 

prodomImg

sp

131

312

S=334 I=38 E=1.5414e-31

Angiotensin-converting enzyme EC=3.4.15.1 ; Carboxypeptidase Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Repeat Transmembrane Zinc

 

prodomImg

Iprscan [G3DSA:1.10.1370.10]

125

663

-

Iprscan [PTHR10514:SF16]

41

672

-

Iprscan IPR001548 [PTHR10514]

41

672

Peptidase M2, peptidyl-dipeptidase A

Iprscan IPR001548 [PF01401]

42

312

Peptidase M2, peptidyl-dipeptidase A

Iprscan IPR001548 [PF01401]

345

657

Peptidase M2, peptidyl-dipeptidase A

Iprscan [seg]

5

21

-

Iprscan [seg]

322

337

-

Iprscan [seg]

656

671

-

Iprscan [SignalP-NN(euk)]

1

18

-

PD004184

345

527

S=563 I=58 E=1.53035e-60

PD004184

270

312

S=145 I=58 E=6.07936e-10

PD237992

42

265

S=445 I=42 E=2.95988e-46

PDA1W0A2

1

114

S=437 I=76 E=2.44123e-45

PDA220C0

250

346

S=402 I=81 E=4.84498e-41

PD335689

605

654

S=149 I=54 E=2.28965e-10

PD407251

562

605

S=131 I=54 E=2.89254e-08

PDA1G3B6

528

560

S=130 I=73 E=3.82338e-08

PDA3E147

232

266

S=110 I=60 E=9.95951e-06

Iprscan [SSF55486]

39

656

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZK9WmZRu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

107 hits
swiss-prot

Swiss-Prot ncbi-blastp

57 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBR2jDcj/XFF4834R_chr33230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBR2jDcj/XFF4834R_chr33230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBR2jDcj/XFF4834R_chr33230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBR2jDcj/XFF4834R_chr33230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.