Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33220eptAXFF4834R_chr33220metal dependent hydrolase

eptA XFF4834R_chr33220
XFF4834R_chr33210
XFF4834R_chr33210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33230
XFF4834R_chr33230
ID eptA
AC XFF4834R_chr33220
LT XFF4834R_chr33220
OR XFF4834R_chr from 3817743 to 3819410 on strand +
DE metal dependent hydrolase
IP Sulfatase;
CL 1 Metabolism GO:0008152
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: sulfuric ester hydrolase activity (GO:0008484)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110713)
MW 61772.7 Da
SQ 555 aa
 
........10........20........30........40........50
| | | | |
MSTWLPEPRKRSGLRALTWSTRPTVSTEALVLLSSLFFALVCNQLFWRTA
MATHPGSIGFAISLMALLVTVHALLLGILVWRWNAKPLLTLLLFTTALAA
HYMDSYNVYLDADMLRNVLHTDHKESRELLTPGLILPLVCYFLIPTTLLW
RTRLRARSVGKTVLVRLGFLLVVAVVGAAGAMLSSQDISALMRNHREVRY
LATPINYIVALRQNLKSESPIKRAPKQPIEHDATATPRAPGSRPRLLLVV
LGETARAQNWGLNGYARQTTPELAQAGVINFPDMHSCGTSTEVSVPCMFS
PYGRRDYNEDMIRGHQSFLHVLEHAGISTLWRDNQSGCKGVCDGLEIQKL
DDATTPGLCADGRCMDEILLSDLAAQVRAKPGDRVVVVHQLGSHGPSYFE
RYPAQFERFKPVCRTADLGSCGRQDIVNAYDNSILYTDHFLNQAIHALRG
LADYDTAMIYLSDHGESLGEKGLYLHGVPYAIAPKEQTHVPMVMWFSPEF
ARDRGLDEACLRHRAGQYTDQDALFPSVLGLMQVKTSVYAPERDLFAKCT
GTTLR
X.species

NP_641554.1 lcl|yjdB-XAC1218

1

555

S=2563 I=89 E=0

inner membrane protein

X.species

YP_362981.1 lcl|XCV1250

1

555

S=2545 I=88 E=0

putative membrane-associated hydrolase

X.species

NP_636492.1 lcl|yjdB-XCC1117

1

551

S=2390 I=81 E=0

inner membrane protein

X.species

lcl|XALc_0888

8

549

S=1849 I=67 E=0

conserved hypothetical protein.

pubmed

1

435

S=1889 I=84 E=0

Putative inner membrane protein

Pubmed 15195943

 

prodomImg

pubmed

106

549

S=913 I=40 E=1.01497e-101

Putative uncharacterized protein

Pubmed 9350862

 

prodomImg

pubmed

60

549

S=880 I=35 E=9.85465e-98

Putative cytoplasmic membrane protein pmrC

Pubmed 14617142

 

prodomImg

pubmed

60

551

S=857 I=35 E=7.37223e-95

Putative membrane protein

Pubmed 10419955,10715011

 

prodomImg

pubmed

101

549

S=853 I=37 E=2.00931e-94

UPF0141 membrane protein yjdB ; Cell Transmembrane

Pubmed 8391535

 

prodomImg

pubmed

417

553

S=705 I=94 E=1.56417e-76

Putative inner membrane protein

Pubmed 15195942

 

prodomImg

pubmed

239

545

S=443 I=33 E=1.08394e-44

Conserved hypothetical integral membrane protein Lipid A 1-phosphoethanolamine transferase

Pubmed 15489235

 

prodomImg

pubmed

247

503

S=360 I=33 E=1.2797e-34

UPF0141 inner membrane protein yhjW ; Cell Transmembrane

Pubmed 8041620

 

prodomImg

pubmed

247

503

S=359 I=33 E=1.33672e-34

EptB

Pubmed 15795227

 

prodomImg

pubmed

247

500

S=356 I=33 E=3.8389e-34

UPF0141 inner membrane protein yhjW ; Cell Transmembrane

Pubmed 7721701

 

prodomImg

sp

62

549

S=862 I=35 E=1.07468e-95

UPF0141 membrane protein yjdB ; Cell inner Transmembrane

 

prodomImg

sp

101

549

S=853 I=37 E=1.3827e-94

UPF0141 membrane protein yjdB ; Cell Transmembrane

 

prodomImg

sp

247

503

S=360 I=33 E=8.80617e-35

UPF0141 inner membrane protein yhjW ; Cell Transmembrane

 

prodomImg

sp

247

500

S=356 I=33 E=2.64172e-34

UPF0141 inner membrane protein yhjW ; Cell Transmembrane

 

prodomImg

sp

248

498

S=208 I=29 E=2.16692e-16

UPF0141 inner membrane protein yhbX ; Cell Transmembrane

 

prodomImg

Iprscan IPR012549 [PF08019]

67

222

Protein of unknown function DUF1705

Iprscan IPR000917 [PF00884]

243

550

Sulfatase

Iprscan [seg]

29

41

-

Iprscan [seg]

88

100

-

Iprscan [seg]

146

155

-

Iprscan [seg]

163

181

-

Iprscan [tmhmm]

29

48

-

Iprscan [tmhmm]

58

80

-

Iprscan [tmhmm]

87

109

-

Iprscan [tmhmm]

129

151

-

Iprscan [tmhmm]

163

185

-

PD005703

242

439

S=459 I=46 E=4.56893e-48

PD461453

441

546

S=289 I=53 E=1.57695e-27

PD921896

59

128

S=236 I=80 E=4.95976e-21

PD676948

11

59

S=166 I=65 E=1.50394e-12

PDA3D7Z2

211

242

S=135 I=78 E=8.57916e-09

PDA1F0L3

428

494

S=113 I=42 E=3.48616e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mY1piSC9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaImJ51/XFF4834R_chr33220.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaImJ51/XFF4834R_chr33220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaImJ51/XFF4834R_chr33220.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaImJ51/XFF4834R_chr33220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.