Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33210XFF4834R_chr_3816982_3817746_f1_XFF4834R-XFF4834R_chr33210XFF4834R_chr33210hypothetical protein

XFF4834R_chr_3816982_3817746_f1_XFF4834R-XFF4834R_chr33210 XFF4834R_chr33210
XFF4834R_chr33200
XFF4834R_chr33200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33220
XFF4834R_chr33220
ID XFF4834R_chr_3816982_3817746_f1_XFF4834R-XFF4834R_chr33210
AC XFF4834R_chr33210
LT XFF4834R_chr33210
OR XFF4834R_chr from 3816982 to 3817746 on strand +
DE hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101028)
MW 27493.2 Da
SQ 254 aa
 
........10........20........30........40........50
| | | | |
MTTLPIRAPTVAHTASGMETHFLVRHLWLPLACVLLASALLMGAGGDQWV
ADALYRLEGGHWLLKDHWFTSGVIHRVGKWLSTAAGVGVLVLAIVAWCRP
RLKVLRWPLTYLAASVALSTSLVSLLKSWTAMDCPWDLSRYGGTQAMIGL
FESRHGIAASGCFPAGHASAGYAWVALYFCALALRPAWRFAGLFIGLAAG
LIFGVAQQLRGAHFLSHDLWSLAVCWVSALALYCVMLQRPRRALGLMLLS
GDAA
X.species

YP_362982.1 lcl|XCV1251

1

254

S=1059 I=82 E=2.27595e-121

hypothetical protein

X.species

NP_641555.1 lcl|XAC1219-XAC1219

1

254

S=1025 I=80 E=3.13193e-117

hypothetical protein

X.species

NP_636493.1 lcl|XCC1118

1

251

S=706 I=60 E=1.48312e-78

hypothetical protein

X.species

lcl|XALc_0889

47

244

S=437 I=52 E=5.82653e-46

conserved hypothetical protein.

pubmed

1

254

S=1020 I=78 E=4.45111e-115

Putative uncharacterized protein

Pubmed 15195943

 

prodomImg

Iprscan [seg]

35

46

-

Iprscan [seg]

84

96

-

Iprscan [seg]

109

126

-

Iprscan [tmhmm]

21

43

-

Iprscan [tmhmm]

80

97

-

Iprscan [tmhmm]

104

126

-

Iprscan [tmhmm]

156

178

-

Iprscan [tmhmm]

190

209

-

Iprscan [tmhmm]

219

237

-

PD834050

1

82

S=266 I=66 E=8.23716e-25

PDA1G6D8

199

254

S=202 I=70 E=4.56226e-17

PD358910

127

198

S=152 I=45 E=5.69447e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one banQWenS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt8eyW9/XFF4834R_chr33210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt8eyW9/XFF4834R_chr33210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt8eyW9/XFF4834R_chr33210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBt8eyW9/XFF4834R_chr33210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.