Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33200XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200XFF4834R_chr33200putative dolichyl-phosphate mannosyltransferase

XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200 XFF4834R_chr33200
XFF4834R_chr33190
XFF4834R_chr33190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33210
XFF4834R_chr33210
ID XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200
AC XFF4834R_chr33200
LT XFF4834R_chr33200
OR XFF4834R_chr from 3815155 to 3816882 on strand +
DE putative dolichyl-phosphate mannosyltransferase
IP Glycosyl transferase, family 39
CL 1.6.11 Glycoprotein GO:0009101
EC
GO InterPro
Biological Process: protein amino acid O-linked glycosylation (GO:0006493)
Cellular Component: membrane (GO:0016020)
Molecular Function: mannosyltransferase activity (GO:0000030)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100810)
MW 63591.5 Da
SQ 575 aa
 
........10........20........30........40........50
| | | | |
MSPAIAASSSRQRALLVALLLIVVSLLAGLGMRQPNPPDEPRFVLAARTM
VETGQWLLPHRGSELYAEKPPVFMWLQAATYELIPHWPVAFLLPSLLAAL
ATLWLTWDIARRLWTRRVAAYAVLALFTVLQFGLMAKRAQIDMVLVALTT
LSLWGMLRHLLRGPDWRAWTLGLFAAGVGTVTKGVGFLPLLLLLPWMALR
RTHWSVLPARALAGRSWGLVLPAFLAGTAVWLGPLGIALWHSDDPQLHAY
AHELLFKQTGTRYAHAWHHVKPFWYYLQVIATLWLPGCLLLPWLLPAWWR
RLRRGDPRYVLLLAWSMLVLLFFSASPGKREVYIFPMLPALCVAAAPLLA
GLLRRRGVRMLLTGYVLLLAIAGLVLGGGITLHLHWAENTAVKRGMELAS
LQSVGFWLIGLGVVGLAAIAWSRGKRAGAALVVMTATLWTVSGLGLMPAL
DPYSSSARLMQRVGQRIGPDAELGMLAWREQNLLQADRPVTDFGFKASWQ
DQWAKAGPWLAQAPHTRWLFVLKQAVPACIDPAQRIDIGESNRNQWQLLP
GTAWHAGCIATASDAEQTGSEGDAD
XFF4834R

XFF4834R_chr36900 lcl|XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900

32

575

S=738 I=33 E=1.2591e-82

X.species

NP_641556.2 lcl|XAC1220-XAC1220

32

575

S=2113 I=79 E=0

hypothetical protein

X.species

YP_362983.1 lcl|XCV1252

32

575

S=2075 I=77 E=0

putative glycosyltransferase

X.species

NP_636494.2 lcl|XCC1119

32

575

S=1742 I=66 E=0

hypothetical protein

X.species

lcl|XALc_2855

33

567

S=777 I=35 E=8.09707e-87

putative glycosyltransferase protein

X.species

NP_644104.1 lcl|XAC3798-XAC3798

32

575

S=767 I=33 E=1.45098e-85

hypothetical protein

X.species

NP_639091.2 lcl|XCC3746

32

575

S=742 I=33 E=1.36166e-82

hypothetical protein

X.species

YP_365654.1 lcl|XCV3923

32

575

S=740 I=33 E=2.75915e-82

putative dolichyl-phosphate mannosyltransferase

pubmed

32

575

S=2004 I=75 E=0

Putative uncharacterized protein ; Cell membrane

Pubmed 15195943

 

prodomImg

Iprscan IPR003342 [PF02366]

63

204

Glycosyl transferase, family 39

Iprscan [seg]

4

31

-

Iprscan [seg]

90

105

-

Iprscan [seg]

177

186

-

Iprscan [seg]

188

195

-

Iprscan [seg]

283

304

-

Iprscan [seg]

311

321

-

Iprscan [seg]

337

362

-

Iprscan [seg]

366

380

-

Iprscan [SignalP-NN(euk)]

1

29

-

Iprscan [tmhmm]

13

32

-

Iprscan [tmhmm]

83

105

-

Iprscan [tmhmm]

118

135

-

Iprscan [tmhmm]

174

196

-

Iprscan [tmhmm]

217

239

-

Iprscan [tmhmm]

274

296

-

Iprscan [tmhmm]

309

328

-

Iprscan [tmhmm]

332

354

-

Iprscan [tmhmm]

361

383

-

Iprscan [tmhmm]

398

420

-

Iprscan [tmhmm]

427

449

-

PDA1I4B9

447

571

S=440 I=62 E=1.00636e-45

PD605865

159

282

S=229 I=46 E=3.45893e-20

PDA1H2I1

32

69

S=144 I=71 E=5.94107e-10

PD572086

306

444

S=114 I=30 E=3.13328e-06

PDA2Q8Q8

70

89

S=102 I=85 E=9.14906e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one E3QgSmzp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQAr6gS/XFF4834R_chr33200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQAr6gS/XFF4834R_chr33200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQAr6gS/XFF4834R_chr33200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQAr6gS/XFF4834R_chr33200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.