Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr33180raxHXFF4834R_chr33180two component system sensor protein RaxH

raxH XFF4834R_chr33180
XFF4834R_chr33170
XFF4834R_chr33170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33190
XFF4834R_chr33190
ID raxH
AC XFF4834R_chr33180
LT XFF4834R_chr33180
OR XFF4834R_chr from 3812933 to 3814222 on strand -
DE two component system sensor protein RaxH
IP Signal transduction histidine kinase-related protein, C-terminal; Signal transduction histidine kinase, homodimeric; Signal transduction histidine kinase, nitrate/nitrite-sensing
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: phosphorylation (GO:0016310)
Biological Process: signal transduction (GO:0007165)
Cellular Component: integral to membrane (GO:0016021)
Cellular Component: membrane (GO:0016020)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: two-component sensor activity (GO:0000155)
transferring phosphorus-containing groups (GO:0016772)

Curated
PM
AN start position modified: Nter end shortened in order to match the start positionof homologs xac1222, xcv1254 and xcc1121. Indeed codson usage was not good in the region where the start was initially predicted.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110318)
MW 46761.2 Da
SQ 429 aa
 
........10........20........30........40........50
| | | | |
MSKQRPLGRRVLVWLFGYTLLMTLAVFGTAQYLHERAEHGVWRSLLNSEL
DSILERSLQDPDYRWQDSDTLRLYRVDDVARTPPVLRTLHPGLHDGLEIA
GRQSAVMVRDTAHAGRLALVLDITDFEALEKFLTRWMLAAGIALIGITLL
MGAYAMARLVRPLVELARDIGALRPERRAQQIAVGPQGSAELYVIADALN
DYLERNSQFVDRERAFIDSASHELRTPIAVIGNAVELALDQPGTPPAVRH
QLQRIAQTSASVEQLITLLLVLAKDPGRLVRSSDALRLDQLLPDIVADHT
HLCADKDLQLVVAPLPPCSVIAPVAIVQTAIGNLLRNAIENSDRGIIRIS
LSAPGVVCIADPGHGMTPEEISAIYTRLARGNVRQGSGIGLELIGRLCEH
LGWHLQLDSNAGQGTVATLDLSGATATGS
XFF4834R

XFF4834R_chr13870 XFF4834R_chr14720552_1587886_f2_XFF4834R-XFF4834R_chr13870

15

419

S=366 I=29 E=1.1055e-37

XFF4834R

XFF4834R_chr08410 XFF4834R_chr09020264_0980535_f1_XFF4834R-XFF4834R_chr08410

38

415

S=275 I=29 E=1.11466e-26

XFF4834R

XFF4834R_chr38410 XFF4834R_chr41490895_4436079_f1_XFF4834R-XFF4834R_chr38410

187

423

S=167 I=29 E=1.49608e-13

XFF4834R

XFF4834R_chr11650 XFF4834R_chr12140989_1302374_f3_XFF4834R-XFF4834R_chr11650

137

426

S=164 I=26 E=3.05807e-13

XFF4834R

XFF4834R_chr09040 XFF4834R_chr09630140_1044050_r2_XFF4834R-XFF4834R_chr09040

216

412

S=155 I=31 E=3.39252e-12

XFF4834R

XFF4834R_chr16120 XFF4834R_chr17370806_1868315_f3_XFF4834R-XFF4834R_chr16120

216

421

S=153 I=26 E=6.93451e-12

XFF4834R

XFF4834R_chr24780 XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

216

415

S=147 I=25 E=3.30218e-11

XFF4834R

XFF4834R_chr32530 XFF4834R_chr35200757_3745873_f2_XFF4834R-XFF4834R_chr32530

216

421

S=142 I=28 E=1.29802e-10

XFF4834R

XFF4834R_chr38890 XFF4834R_chr42040787_4481157_r1_XFF4834R-XFF4834R_chr38890

136

407

S=134 I=23 E=1.28568e-09

XFF4834R

XFF4834R_chr16110 XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

216

421

S=131 I=25 E=3.56577e-09

XFF4834R

XFF4834R_chr35800 XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

216

419

S=128 I=28 E=6.45113e-09

XFF4834R

XFF4834R_chr35690 XFF4834R_chr38910286_4142022_f1_XFF4834R-XFF4834R_chr35690

211

426

S=119 I=26 E=8.52003e-08

XFF4834R

XFF4834R_chr32620 XFF4834R_chr35330226_3757098_r1_XFF4834R-XFF4834R_chr32620

162

415

S=111 I=25 E=8.22115e-07

XFF4834R

XFF4834R_chr07370 XFF4834R_chr07780823_0854325_r1_XFF4834R-XFF4834R_chr07370

188

421

S=109 I=25 E=1.26029e-06

XFF4834R

XFF4834R_chr03000 baeS-XFF4834R_chr03000

214

426

S=106 I=25 E=2.91055e-06

sensory histidine kinase in two-component regulatory system with BaeR

XFF4834R

XFF4834R_chr04920 barA-XFF4834R_chr04920

216

416

S=104 I=23 E=5.40527e-06

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr18250 XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250

136

421

S=103 I=25 E=6.83995e-06

XFF4834R

XFF4834R_chr13120 XFF4834R_chr13870082_1495317_r1_XFF4834R-XFF4834R_chr13120

326

419

S=101 I=30 E=1.48611e-05

XFF4834R

XFF4834R_chr16090 XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

216

421

S=96 I=27 E=5.74064e-05

X.species

NP_641558.1 colS-XAC1222

1

429

S=2192 I=99 E=0

two-component system sensor protein

X.species

YP_362985.1 XCV1254

1

429

S=2147 I=97 E=0

two-component system sensor protein

X.species

NP_636496.1 colS-XCC1121

1

427

S=1956 I=88 E=0

two-component system sensor protein

X.species

XALc_0891 XALc_0891

7

424

S=1171 I=60 E=1.16729e-134

putative two-component system sensor transmembrane protein

X.species

YP_365095.1 colS-XCV3364

15

419

S=367 I=29 E=2.93391e-37

two-component system sensor protein

X.species

NP_638453.1 colS-XCC3106

46

419

S=346 I=29 E=1.00143e-34

two-component system sensor protein

X.species

NP_643557.1 colS-XAC3249

46

419

S=341 I=29 E=3.97088e-34

two-component system sensor protein

X.species

XALc_0662 XALc_0662

106

419

S=338 I=30 E=1.09175e-33

putative two-component system sensor protein

X.species

XALc_2772 XALc_2772

44

424

S=320 I=29 E=1.37921e-31

putative two-component system sensor protein

X.species

NP_636171.1 colS-XCC0780

7

415

S=319 I=30 E=2.24738e-31

two-component system sensor protein

X.species

YP_362619.1 XCV0888

86

415

S=274 I=31 E=6.04678e-26

two-component system sensor protein

X.species

NP_641187.1 colS-XAC0835

86

415

S=272 I=31 E=8.64512e-26

two-component system sensor protein

X.species

YP_364041.1 qseC-XCV2310

190

426

S=179 I=26 E=1.82897e-14

two-component system sensor protein

X.species

NP_638697.1 tctE-XCC3351

158

426

S=178 I=27 E=2.41755e-14

two-component system sensor protein

X.species

XALc_0246 phoQ-XALc_0246

136

419

S=173 I=26 E=1.02786e-13

probable two-component system sensor protein phoq

X.species

YP_365800.1 XCV4069

145

429

S=172 I=28 E=1.16131e-13

putative two-component system sensor protein

X.species

NP_644275.1 ygiY-XAC3975

187

423

S=169 I=29 E=2.72913e-13

two-component system sensor protein

X.species

XALc_1974 XALc_1974

216

415

S=162 I=28 E=2.25091e-12

putative two-component system sensor-response regulator hybrid protein

X.species

NP_639234.1 ygiY-XCC3894

191

395

S=161 I=30 E=2.54314e-12

two-component system sensor protein

X.species

NP_643789.1 tctE-XAC3482

137

426

S=161 I=25 E=2.61053e-12

two-component system sensor protein

pubmed

1

427

S=2081 I=94 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 15195943

 

prodomImg

pubmed

83

422

S=311 I=31 E=6.81098e-29

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 9425686

 

prodomImg

pubmed

1

428

S=303 I=27 E=7.36081e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17166231

 

prodomImg

pubmed

1

428

S=303 I=27 E=7.42527e-28

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15491368

 

prodomImg

pubmed

136

414

S=213 I=25 E=5.71365e-17

Sensor protein qseC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

Pubmed 10675023

 

prodomImg

sp

136

414

S=213 I=25 E=3.88706e-17

Sensor protein qseC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

 

prodomImg

sp

207

429

S=200 I=27 E=1.39918e-15

Heme sensor protein hssS EC=2.7.13.3 ; ATP-binding Cell membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regu

 

prodomImg

sp

132

428

S=183 I=24 E=1.6922e-13

Sensor histidine kinase ykoH EC=2.7.13.3 ; ATP-binding Cell membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component

 

prodomImg

sp

145

423

S=182 I=28 E=2.57161e-13

Sensor-type histidine kinase prrB EC=2.7.13.3 ; ATP-binding Cell membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

 

prodomImg

sp

145

423

S=182 I=28 E=2.57161e-13

Sensor-type histidine kinase prrB EC=2.7.13.3 ; ATP-binding Cell membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component reg

 

prodomImg

Iprscan IPR004358 [PR00344]

355

369

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

385

403

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

409

422

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

283

422

ATPase-like, ATP-binding domain

Iprscan [PTHR23283:SF34]

102

421

-

Iprscan [PTHR23283]

102

421

-

Iprscan IPR003594 [PF02518]

327

421

ATPase-like, ATP-binding domain

Iprscan IPR003661 [PF00512]

214

275

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003660 [PF00672]

138

205

HAMP linker domain

Iprscan IPR003661 [SM00388]

212

278

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003594 [SM00387]

322

425

ATPase-like, ATP-binding domain

Iprscan IPR005467 [PS50109]

219

425

Signal transduction histidine kinase, core

Iprscan IPR003660 [PS50885]

157

211

HAMP linker domain

Iprscan [SignalP-NN(euk)]

1

30

-

Iprscan [tmhmm]

12

34

-

Iprscan [tmhmm]

132

154

-

PDA1M7Q6

5

130

S=515 I=77 E=6.80422e-55

PDA1Q4Q0

131

215

S=406 I=94 E=1.05916e-41

PD917075

272

332

S=271 I=87 E=2.17383e-25

PD752323

284

384

S=157 I=40 E=1.7429e-11

PD297499

288

419

S=129 I=32 E=4.23065e-08

PD822731

129

271

S=119 I=24 E=5.99108e-07

Iprscan IPR003594 [SSF55874]

277

421

ATPase-like, ATP-binding domain

Iprscan IPR009082 [SSF47384]

202

274

Signal transduction histidine kinase, homodimeric

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wXLjUG42)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

187 hits
swiss-prot

Swiss-Prot ncbi-blastp

120 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

20 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKEVD5l/XFF4834R_chr33180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKEVD5l/XFF4834R_chr33180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKEVD5l/XFF4834R_chr33180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKEVD5l/XFF4834R_chr33180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.