Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32980rfaXXFF4834R_chr32980putative lipoplysaccharide core biosynthesis protein RfaX

rfaX XFF4834R_chr32980
XFF4834R_chr32970
XFF4834R_chr32970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32990
XFF4834R_chr32990
ID rfaX
AC XFF4834R_chr32980
LT XFF4834R_chr32980
OR XFF4834R_chr from 3796726 to 3797238 on strand +
DE putative lipoplysaccharide core biosynthesis protein RfaX
IP
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro


Curated
PM
AN functional study in Xcc, LPS biosynthesis, pathogenicity related
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 18997.2 Da
SQ 170 aa
 
........10........20........30........40........50
| | | | |
MRKIFSSQRIETAEGVANLLRDAGIEIRISNGRSYQSKRGGQFSYLEQSN
AQAQPTVWIVHANDQPRARELLRDARLLDTTRRDLPNVEYTFREGENGSS
SSARSWAWRIRLVLLLVIGAVAMVVVMRHRNAPTQLAPAAQPASQQAPAP
DAARPAAEDDEVRVRIQPTR
Show or not Domain decomposition
 
X.species

NP_641578.1 lcl|pthX-XAC1242

1

170

S=547 I=67 E=1.20699e-59

pathogenicity-related protein

X.species

YP_363008.1 lcl|XCV1277

1

170

S=538 I=66 E=1.52608e-58

hypothetical protein

X.species

NP_636519.1 lcl|XCC1144

1

168

S=480 I=61 E=1.59867e-51

pathogenicity-related protein

X.species

lcl|XALc_0910

1

131

S=310 I=50 E=6.86159e-31

conserved hypothetical protein.

pubmed

1

168

S=480 I=61 E=5.33352e-50

First putative translational start site; putative

Pubmed 2135951

 

prodomImg

pubmed

16

168

S=400 I=57 E=2.54285e-40

Second putative translational start; putative

Pubmed 2135951

 

prodomImg

Iprscan [seg]

67

85

-

Iprscan [seg]

99

109

-

Iprscan [seg]

132

157

-

Iprscan [tmhmm]

110

127

-

PD032643

16

169

S=399 I=57 E=7.49714e-41

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SZcxbWL0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqANO5Y/XFF4834R_chr32980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqANO5Y/XFF4834R_chr32980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqANO5Y/XFF4834R_chr32980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqANO5Y/XFF4834R_chr32980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.