Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32920XFF4834R_chr35640618_3790755_r1_acur-XFF4834R_chr32920XFF4834R_chr32920hypothetical protein

XFF4834R_chr35640618_3790755_r1_acur-XFF4834R_chr32920 XFF4834R_chr32920
XFF4834R_chr32910
XFF4834R_chr32910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32930
XFF4834R_chr32930
ID XFF4834R_chr35640618_3790755_r1_acur-XFF4834R_chr32920
AC XFF4834R_chr32920
LT XFF4834R_chr32920
OR XFF4834R_chr from 3790618 to 3790755 on strand -
DE hypothetical protein
IP
CL 10 cryptic genes
EC
GO InterPro


Curated
PM
AN acur, petite proteine, aucune similarite proteique significative (blastP), forte identite nucleique avec des Xanthos (blastN)
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by poussier (20101015)
MW 4476.9 Da
SQ 45 aa
 
........10........20........30........40........50
| | | | |
MSGRRTGSGASVLSRNEWQSISLPADLGEGNCPKCQSAGAVVAAG
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gbPrMlpY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0zUB7X/XFF4834R_chr32920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0zUB7X/XFF4834R_chr32920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0zUB7X/XFF4834R_chr32920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0zUB7X/XFF4834R_chr32920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.