Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32780XFF4834R_chr35510796_3776984_r2_acur-XFF4834R_chr32780XFF4834R_chr32780hypothetical protein

XFF4834R_chr35510796_3776984_r2_acur-XFF4834R_chr32780 XFF4834R_chr32780
XFF4834R_chr32780
XFF4834R_chr32780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3471
XFF4834R_chr_3471
ID XFF4834R_chr35510796_3776984_r2_acur-XFF4834R_chr32780
AC XFF4834R_chr32780
LT XFF4834R_chr32780
OR XFF4834R_chr from 3776796 to 3776984 on strand -
DE hypothetical protein
IP
CL 10 cryptic genes
EC
GO InterPro


Curated
PM
AN petite proteine, acur, aucune similarite proteique blastP, forte identite nucleique avec orthologue de Xantho, signal peptide potentiel (4/5 via signal3P)
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by poussier (20101014)
MW 6981.2 Da
SQ 62 aa
 
........10........20........30........40........50
| | | | |
MGARQRMRCARRAHGASGSRNCRKSCIALRCDNMSHKLARIYCVGSLPMG
YVQVQQRLRLTG
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one q44ckeTA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8LaA_Q/XFF4834R_chr32780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8LaA_Q/XFF4834R_chr32780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8LaA_Q/XFF4834R_chr32780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8LaA_Q/XFF4834R_chr32780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.