Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32690hrpXXFF4834R_chr32690AraC-type transcriptional regulator HrpX

hrpX XFF4834R_chr32690
XFF4834R_chr32680
XFF4834R_chr32680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3459
XFF4834R_chr_3459
ID hrpX
AC XFF4834R_chr32690
LT XFF4834R_chr32690
OR XFF4834R_chr from 3764786 to 3766216 on strand -
DE AraC-type transcriptional regulator HrpX
IP Helix-turn-helix, AraC domain
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: sequence-specific DNA binding (GO:0043565)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 52497 Da
SQ 476 aa
 
........10........20........30........40........50
| | | | |
MILSTYFAAISALSYAERLPTYTSRMLVGAWPQGLQHLQQRRDGQGAVDS
ADDEVSLFGASGDALLILEYQEEAEDAYRQALKAMRGHQRQLRLLSCRNT
AWLMLSQRRLSAALNCFAQLAMDRETSPSLCGESLLGKSLTHFHLGQSTL
ALQTLERASEVLADLESGASEWLRIANALRLDMIAQLRIRRSDRMSDHVF
WQATLRQEDAAHAFEPSDLRACIADLAESMPVLAQRMRHVRSLLRIAGGD
TFGFDAQIDALPAAATGCPPCARQDAQVELALAALAVGRADLAERALAGA
GRHHAPRWNLEFEYCQAKISQAMGRTEQALLLYNRYALDAVQCLRSEVQA
PRLLESGTPAHVSDDISARLPAKYRRAYSYMITNAHRSDLSINEVAAQIG
VTGRALQQAFKSATGLSPTQVLRRYRMQSIRDELLAEGGCGSVLQAASRW
GVGSRSALAKGYRQHFNEAPMETLQR
X.species

NP_641601.1 lcl|hrpXct-XAC1266

1

476

S=2363 I=95 E=0

HrpX protein

X.species

YP_363046.1 lcl|hrpXv-XCV1315

1

476

S=2317 I=94 E=0

AraC-type transcriptional regulator HrpX

X.species

NP_636541.1 lcl|hrpXct-XCC1167

1

476

S=2170 I=87 E=0

HrpX protein

X.species

YP_364077.1 lcl|XCV2346

373

474

S=100 I=33 E=7.88475e-05

AraC family transcriptional regulator

pubmed

1

476

S=2370 I=96 E=0

HrpX ; DNA-binding Transcription regulation

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

476

S=2335 I=94 E=0

HrpXct protein ; DNA-binding Transcription regulation

Pubmed 10902926

 

prodomImg

pubmed

1

476

S=2317 I=94 E=0

HrpXv ; DNA-binding Transcription regulation

Pubmed 8655542

 

prodomImg

pubmed

1

476

S=2277 I=92 E=0

Hrp protein ; DNA-binding Transcription regulation

Pubmed 7626786

 

prodomImg

pubmed

1

476

S=2163 I=87 E=0

Hrp protein ; DNA-binding Transcription regulation

Pubmed 7626786

 

prodomImg

pubmed

187

438

S=1162 I=90 E=6.00858e-132

HrpXo protein ; DNA-binding Transcription regulation

Pubmed 8458844

 

prodomImg

pubmed

1

80

S=403 I=98 E=5.18936e-40

HrpXo protein ; DNA-binding Transcription regulation

Pubmed 8458844

 

prodomImg

pubmed

1

476

S=661 I=37 E=3.32572e-71

Regulatory protein hrpB ; Activator DNA-binding Hypersensitive response elicitation Plasmid Transcription regulation

Pubmed 1479894

 

prodomImg

pubmed

311

476

S=375 I=47 E=1.38644e-36

Putative uncharacterized protein ; DNA-binding Transcription regulation

Pubmed 10403415,11990489

 

prodomImg

pubmed

62

212

S=192 I=29 E=1.94612e-14

Putative uncharacterized protein ; DNA-binding Transcription regulation

Pubmed 10403415,11990489

 

prodomImg

sp

1

476

S=661 I=37 E=2.28826e-71

Regulatory protein hrpB ; Activator DNA-binding Hypersensitive response elicitation Plasmid Transcription regulation

 

prodomImg

sp

370

475

S=149 I=35 E=2.56427e-09

Probable thc operon regulatory protein ; DNA-binding Transcription regulation

 

prodomImg

sp

353

476

S=147 I=32 E=3.73064e-09

HTH-type transcriptional regulator eutR ; Activator DNA-binding regulation

 

prodomImg

sp

353

476

S=136 I=30 E=8.09878e-08

HTH-type transcriptional regulator eutR ; Activator DNA-binding regulation

 

prodomImg

sp

382

472

S=125 I=32 E=1.77354e-06

Uncharacterized HTH-type transcriptional regulator yqhC ; DNA-binding regulation

 

prodomImg

Iprscan IPR000005 [PF00165]

376

423

Helix-turn-helix, AraC type

Iprscan IPR018060 [SM00342]

389

474

Helix-turn-helix, AraC domain

Iprscan IPR018062 [PS00041]

426

470

Helix-turn-helix, AraC type, subdomain 2

Iprscan IPR018060 [PS01124]

375

476

Helix-turn-helix, AraC domain

PD963330

44

382

S=906 I=57 E=3.36001e-102

PDA1K024

1

43

S=225 I=100 E=9.2497e-20

PDA1H3D0

420

476

S=215 I=69 E=1.70145e-18

PDA1K023

383

419

S=187 I=100 E=4.31408e-15

PDA3H5M7

44

84

S=137 I=71 E=4.68357e-09

PDA1S268

384

418

S=116 I=69 E=1.66987e-06

Iprscan [SSF48452]

46

336

-

Iprscan IPR009057 [SSF46689]

370

424

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NdNkP3HA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

68 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB36Ym5w/XFF4834R_chr32690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB36Ym5w/XFF4834R_chr32690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB36Ym5w/XFF4834R_chr32690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB36Ym5w/XFF4834R_chr32690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.